KEGG   Bacillus subtilis subsp. subtilis 168: BSU37810
Entry
BSU37810          CDS       T00010                                 

Symbol
spsL
Name
(RefSeq) spore coat polysaccharide biosynthesis protein SpsL
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00523  Polyketide sugar unit biosynthesis
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU37810 (spsL)
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BSU37810 (spsL)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU37810 (spsL)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BSU37810 (spsL)
SSDB
Motif
Pfam: dTDP_sugar_isom Cupin_2
Other DBs
NCBI-GeneID: 2914201
NCBI-ProteinID: YP_054595
Pasteur: BG14195
BSORF: BG14195
UniProt: Q7WY56 A0A6M4JQA9
Position
complement(3882979..3883434)
AA seq 151 aa
MIDGVKVKKLMKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLYDLREDSKTKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTMSYNPDQPDEKRIPWDDETIGFNWNTEFR
NT seq 456 nt   +upstreamnt  +downstreamnt
gtgattgatggagtcaaggtgaaaaaattgatgaagcatagcgatgacagaggctttttt
gctgagctggtccgggacgatgagaatctccttgagcattttgggcaggcctcttggtcg
aaaagctatccgggtgtgattaaggcatttcattatcatgagaagcaggatgatctctgg
ttcttcccaaccggccacgctcaggttgtcctatacgatcttcgagaggattcaaagaca
aaaggagaaacggacgtctattatatgggcgaagacaacccgatgctgttattaatccca
aaaggggtggctcacggatatagagtgctgggagagacgccgctgacaattatctatttt
accaccatgtcgtataacccggatcagcctgatgaaaaaagaattccgtgggatgatgag
acgatcggttttaactggaacactgaattcagataa

DBGET integrated database retrieval system