KEGG   Bacillus subtilis subsp. subtilis 168: BSU37820
Entry
BSU37820          CDS       T00010                                 

Symbol
spsK
Name
(RefSeq) spore coat polysaccharide biosynthesis protein SpsK
  KO
K00067  dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00523  Polyketide sugar unit biosynthesis
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU37820 (spsK)
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BSU37820 (spsK)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU37820 (spsK)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     BSU37820 (spsK)
SSDB
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 3Beta_HSD adh_short NAD_binding_10 NmrA KR DapB_N
Other DBs
NCBI-GeneID: 937225
NCBI-ProteinID: NP_391661
Pasteur: BG10619
BSORF: BG10619
UniProt: P39631 A0A6M3ZHU1
Position
complement(3883427..3884278)
AA seq 283 aa
MTKVLVTGAGGQLGLELCRQLKQAGYEVIALTKKMMNIADQRSVRHSFGHYQPDIVVNSA
AFTSVDQCEKELDKAYLINGIGAYYTALESTRIGAQYVHISTDYVFNGKGTQPYREDDPL
DPKTIYGKSKRLGEELIRLTTKDSTIIRTSWVYGHGGSNFVETMLKLAETKQELRVVSDQ
IGSPTYTKDLAEAVIKLFSHPPGIYHVSNSGICSWYEFATAIMEESGLETAILSVTTEEY
GNKTPRPAYSVLSHRAIEEAGIRPRHWREALREYLQERSSACD
NT seq 852 nt   +upstreamnt  +downstreamnt
ttgacaaaggtattggtgactggggcgggaggacagcttggcttggaactatgccgccag
ctgaagcaagccggatatgaggtcattgcgttaacaaagaagatgatgaacattgctgac
cagcgctcagtacggcattcgtttggccattatcagccggatatcgtggtcaatagcgcc
gcgtttacgtcggttgatcaatgcgagaaagagcttgataaagcgtacttgattaacgga
atcggcgcttattatacagcgcttgagtcaacccgcatcggagctcaatatgttcatatc
agcacggactatgtattcaatgggaaaggaacccagccatatagggaagacgatcccctc
gatccgaaaaccatttatggcaaaagcaaaaggctcggagaagaactgatacgattaacg
acaaaagacagcacgatcatcaggacatcgtgggtgtacggacatggcggcagtaatttc
gttgaaaccatgctgaaacttgctgaaacgaaacaagagcttcgggttgtcagcgatcaa
attggttcgccgacttatacgaaggatttagcagaagcggtcatcaagctgttcagccat
ccgccgggcatctatcatgtcagcaattcaggcatatgcagctggtatgagtttgcgacg
gcaattatggaagaaagcgggctggaaacagccattttgtctgtaacgacagaggaatac
gggaacaaaacgccccgtccggcatactctgtgctgagccatcgggctattgaagaagcc
ggcatccgcccccgccactggcgggaagcgttacgagagtatttgcaggaaaggagcagt
gcgtgtgattga

DBGET integrated database retrieval system