KEGG   Bacillus subtilis subsp. subtilis 168: BSU37840
Entry
BSU37840          CDS       T00010                                 

Symbol
spsI
Name
(RefSeq) dTDP-glucose pyrophosphorylase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00523  Polyketide sugar unit biosynthesis
bsu00525  Acarbose and validamycin biosynthesis
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU37840 (spsI)
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BSU37840 (spsI)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU37840 (spsI)
   00525 Acarbose and validamycin biosynthesis
    BSU37840 (spsI)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     BSU37840 (spsI)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Other DBs
NCBI-GeneID: 937229
NCBI-ProteinID: NP_391663
Pasteur: BG10617
BSORF: BG10617
UniProt: P39629 A0A6M3ZIA6
Position
complement(3885239..3885979)
AA seq 246 aa
MKGVILAGGNGSRLMPLTKAVNKHLLPVGPYPMIYWSIMKLQEAGIKDILLISQKEHMPQ
FYKLLGNGEELGVTITYQVQPAASGISDGLSYAKRFTKKESFILLLGDNIFEDSLKPYTE
RFEQQGKGAKVLLKEVDDPERFGIAEIDEKNKRIRSIIEKPEQPPTNLCVTGIYMYDAEV
FSYIEQISPSKRGELEITDVNNLYIENSQLTYDVLSGWWVDAGTHESLYLASQLVHQALR
KGQDEK
NT seq 741 nt   +upstreamnt  +downstreamnt
gtgaaaggtgttattttagccggaggaaacggctcacgccttatgcccttaacgaaagcc
gtcaacaagcatttgcttcctgtaggcccgtatccgatgatatactggtcgattatgaag
ctgcaggaagccggaataaaagacattttactcatcagccaaaaggagcatatgccgcaa
ttttacaaactgcttgggaacggggaagagcttggcgttactatcacttatcaagtacag
ccggcagcatcgggcatttcggatgggctgtcttatgcaaagcgctttacgaaaaaagag
tctttcattttattattaggtgataatatatttgaagattcattaaagccttatacagaa
cgctttgaacagcaggggaaaggagcaaaagtgcttctgaaagaagttgatgacccggaa
cgtttcgggattgctgagattgatgagaaaaacaagcggattcgttccatcatcgaaaag
cccgaacagccaccgaccaacctttgtgttaccggcatttatatgtatgatgcagaggtg
ttttcatatattgaacaaatatcaccatcaaagcgcggcgagctggaaatcaccgatgtg
aataatctatacatcgaaaacagccagcttacgtatgatgtgttatcaggctggtgggta
gatgccggaactcacgaatcgctttatctcgcttcccagcttgtacaccaggctttacgg
aaaggacaggacgaaaagtga

DBGET integrated database retrieval system