KEGG   Bacillus subtilis subsp. subtilis 168: BSU37850
Entry
BSU37850          CDS       T00010                                 

Gene name
spsG
Definition
(RefSeq) spore coat polysaccharide biosynthesis protein SpsG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyco_tran_28_C LpxB Glycos_transf_1 Epimerase_2 Glyco_trans_1_4 UDPGT DHFR_1
Other DBs
NCBI-GeneID: 937230
NCBI-ProteinID: NP_391664
Pasteur: BG10615
BSORF: BG10615
UniProt: P39627 A0A6M4JQD4
Position
complement(3886004..3887023)
AA seq 339 aa
MHVGIFADGGYEKGMGHVVRMKRLAEGLKQRCLITFYTNQDSEAFLHEEHWQVIVKPELQ
QHEFILREIKSKKLDLLLFDILGAPAELLKKIKTETDAKIVLFEEKNGKSIQYSDAVING
IYGDIRSRVYVQGNTRIYEGPDYLILHPAFQAAREDYTLKKDCRNILVALGGSDPKQLIF
KVLAAADQVPDIKDKNMMFVMGSASPHQEAVRRRIEKKPQYKMIEQTNDMAGLMKQADAA
IVAGGISLYEAICIGVPCLVLSQVEHQTATAKTFADQGAALDLGLGELVPDETLIYQMSR
IMSSYPLRLSLHKGGRPLVDGKGIIRVTAILQDLYEQEI
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgcatgttgggatcttcgcagacggcggctatgaaaagggaatgggccatgttgtccgg
atgaagaggcttgcggaggggctcaaacagcgatgcttgattacgttttatacgaatcag
gattctgaagcgtttcttcatgaagagcattggcaggtcatcgtaaagccggagctgcag
cagcacgaatttattctccgggaaataaaaagcaagaagcttgatttgcttttgtttgat
attctaggcgcgcctgcagagctgttaaagaaaataaagacggagacagatgcgaaaatt
gttctttttgaagagaaaaacggtaaatcgattcaatatagtgacgcagtcattaacgga
atttacggtgacatcagaagcagggtgtacgttcagggaaacacacgcatctatgaaggt
ccggactatcttattcttcaccccgcctttcaggccgcaagagaggattacacacttaag
aaagactgccgcaatatccttgttgcattaggaggaagtgatccgaagcagcttattttt
aaagtgctggctgccgctgatcaagtccccgacataaaagacaaaaacatgatgtttgtg
atggggagcgcttcaccgcatcaagaggcagtccgaaggcggatcgaaaagaagccgcag
tacaagatgatcgaacagacaaatgatatggcaggtttgatgaaacaagcggacgcagcc
attgtcgctggcggcatctctctatatgaagccatttgcatcggcgtgccgtgccttgtt
ctttctcaggttgagcatcaaacggctacagccaaaacatttgctgaccaaggcgccgct
cttgatcttggattgggtgagcttgtaccggatgaaacactcatctatcagatgtcacgc
attatgagcagctatcctcttcgcctttctttgcacaagggaggaaggccgctcgtggat
ggcaaaggcattatacgggtaacagctattcttcaagatttatatgaacaagagatataa

DBGET integrated database retrieval system