KEGG   Bacillus subtilis subsp. subtilis 168: BSU37860
Entry
BSU37860          CDS       T00010                                 

Gene name
spsF
Definition
(RefSeq) spore coat polysaccharide biosynthesis protein SpsF
  KO
K07257  spore coat polysaccharide biosynthesis protein SpsF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU37860 (spsF)
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3
Other DBs
NCBI-GeneID: 937232
NCBI-ProteinID: NP_391665
Pasteur: BG10614
BSORF: BG10614
UniProt: P39626 A0A6M4JQD7
Position
complement(3887026..3887748)
AA seq 240 aa
MNDILFIIQARMGSTRLPGKVLRPLGSNRLLDILVHRVRQSAFYQKDRDNLVIATSDKET
DDILEAHCIKQGFRVFRGSEERVLDRFVKVIEAVKPSVIIRLTGDNPFVDPELLDVMIQA
HFDQGSDYTYILNAPLGICGEVVNANLLIDISRIQALEDQYQEHVTLYIRNHPALYRVQF
LEAPERFRAPQYRLTIDTKEDYESIKALYQKAGERPDVSASELITLLNRNPDAATEREAD
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaatgatattctctttatcattcaagcaagaatgggttcaacaaggcttccgggaaaa
gtgcttcggccgctcggatcgaatcgtttacttgatattctcgttcaccgtgtccggcaa
agcgcgttttaccaaaaggatcgggataatcttgtcatcgccacgtctgacaaagaaact
gacgacatattagaggcgcactgtatcaaacaaggctttcgtgttttccgcgggagcgaa
gaacgtgtcctcgataggtttgtgaaggtcatagaagctgttaaaccgtcagtcatcatc
cggttaacaggtgataatccgtttgtcgatcctgagctgctcgatgtaatgattcaggcg
cattttgatcaaggctcggattatacgtatatcctgaatgccccattagggatttgcggc
gaagtggtcaacgccaacctgttaattgacatcagccgtattcaggctttggaggatcaa
tatcaggagcatgtcacgttatatataaggaatcatccagctctttatcgtgttcagttt
ttagaggcgccggaacgatttcgcgcccctcaatatcggctgaccattgatacaaaggaa
gactatgaatcgataaaggccctctatcaaaaagcaggcgagcgccccgatgtatccgcc
tcagagcttatcacccttctgaaccggaaccccgatgcggcaaccgaacgagaggctgac
tag

DBGET integrated database retrieval system