KEGG   Bacillus subtilis subsp. subtilis 168: BSU37870
Entry
BSU37870          CDS       T00010                                 

Symbol
spsE
Name
(RefSeq) spore coat polysaccharide biosynthesis protein SpsE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NeuB SAF
Other DBs
NCBI-GeneID: 937233
NCBI-ProteinID: NP_391666
Pasteur: BG10613
BSORF: BG10613
UniProt: P39625 A0A6M3ZHP3
Structure
PDB: 
1VLI

Position
complement(3887741..3888862)
AA seq 373 aa
MAAFQIANKTVGKDAPVFIIAEAGINHDGKLDQAFALIDAAAEAGADAVKFQMFQADRMY
QKDPGLYKTAAGKDVSIFSLVQSMEMPAEWILPLLDYCREKQVIFLSTVCDEGSADLLQS
TSPSAFKIASYEINHLPLLKYVARLNRPMIFSTAGAEISDVHEAWRTIRAEGNNQIAIMH
CVAKYPAPPEYSNLSVIPMLAAAFPEAVIGFSDHSEHPTEAPCAAVRLGAKLIEKHFTID
KNLPGADHSFALNPDELKEMVDGIRKTEAELKQGITKPVSEKLLGSSYKTTTAIEGEIRN
FAYRGIFTTAPIQKGEAFSEDNIAVLRPGQKPQGLHPRFFELLTSGVRAVRDIPADTGIV
WDDILLKDSPFHE
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggcagcgtttcagatcgcgaataaaactgtaggcaaagacgctcctgtttttattatt
gctgaggcggggattaatcatgacgggaagcttgatcaggcttttgcgctgatagacgcc
gcggcggaagcgggagcggatgccgtgaaatttcaaatgttccaagctgataggatgtac
cagaaagatcctggtttgtacaagacggcagcgggcaaggacgtctctattttttctttg
gttcaatctatggaaatgcctgctgagtggattttaccgctattggattactgccgcgaa
aagcaggtgatctttttaagtacggtatgtgacgaggggtcagctgatctgcttcagtct
acctcgccgagcgcttttaaaatcgcatcctatgaaattaaccatctcccgctgcttaaa
tatgtcgcccggctgaacaggccgatgattttctcgacagccggagctgaaatctctgat
gttcacgaagcttggcgcaccatcagggcagagggaaacaatcaaattgccataatgcat
tgtgtggcgaaatacccagcaccgccggagtacagcaacctcagcgtcattccgatgctt
gccgccgcttttcctgaggcggtaatcggcttctccgatcatagcgagcatccgacagaa
gcgccgtgtgccgcggttcggctcggagcaaaactgatagaaaagcattttacgatcgat
aaaaatctgccgggtgctgaccactcgtttgcattaaatccggatgaattgaaagaaatg
gtcgatggcatcaggaaaacggaagctgagctgaaacaggggatcacaaagccggtctct
gaaaaactgcttggcagttcatacaaaacaacgaccgccatcgaaggagaaatcagaaac
tttgcatacagaggcatttttacaacagctccgattcaaaaaggtgaagcctttagtgaa
gacaatatcgcagtgcttcggcccggacaaaagccgcaggggctgcacccgagatttttt
gaactgctgaccagcggtgttcgggctgtaagagacattccagccgacacaggcattgtc
tgggatgacattttactgaaggacagcccgtttcatgaatga

DBGET integrated database retrieval system