KEGG   Bacillus subtilis subsp. subtilis 168: BSU37880Help
Entry
BSU37880          CDS       T00010                                 

Gene name
spsD
Definition
(RefSeq) spore coat polysaccharide biosynthesis protein SpsD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_3 Acetyltransf_10 FR47 Acetyltransf_8 Acetyltransf_6 Acetyltransf_4 Toprim_N
Motif
Other DBs
NCBI-GeneID: 937250
NCBI-ProteinID: NP_391667
Pasteur: BG10612
BSORF: BG10612
UniProt: P39624
Position
complement(3888862..3889731)
Genome map
AA seq 289 aa AA seqDB search
MYTVKENVSKEAIEEFLQSRKLTLDVPYQFSLGLFENSRLQGVLLYEDSLWESKVLQKKV
MNVKLLAANSTGQLKRLFEAFYTVRQMDETDFIFVRVPAEDIGAAHVIQQQPSSYFVGSL
LKLAMPPSFYDKTPPFFELGPPEPGDTEAICELARDSFTKSRYFQDPHLSRDAANEIFQE
WTRNNLNGRAAVNIVAKHNGEVIGYLQGLSRDDECILDLMAVKPGFEGKRIAFHLLANLI
EQPETQKHRTVTAGTQLHNVRAIRLYERMGFTAEQSYYYYHIWPGKEAK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgtatacggtaaaagaaaatgtctccaaagaggcaattgaggaatttctccaaagcaga
aagcttacattggatgttccgtatcaattttccctcggcctttttgaaaacagcaggctc
caaggcgtattgctttacgaagattctttgtgggaaagcaaggtgcttcagaagaaagtc
atgaacgtcaaacttcttgcggcaaatagtaccgggcagctaaagaggctgtttgaagct
ttttatactgtacgccaaatggatgaaacggattttatctttgtccgtgttccggctgaa
gatatcggagccgcgcatgtgatacaacagcagccatcctcttactttgtcgggagtttg
ctgaagctggcgatgcctccgtctttttatgacaaaacaccgccattttttgaactgggc
ccgcctgagcccggagacacagaagcgatatgtgagctggcccgagactcgtttacaaaa
agcagatattttcaggatcctcatctcagccgcgatgcagcaaacgaaatatttcaggag
tggacacgaaacaatctgaatggaagggcggcggtcaatattgtcgctaaacacaatggc
gaggtcatcggctatcttcagggcttatcaagagatgatgagtgcattctcgatttgatg
gctgtaaagccgggatttgaagggaaacgtattgcgtttcatttattggcgaatctcata
gaacaaccggagacccagaagcatagaacggtaacagcggggacgcagcttcacaatgta
agggcgatccgcctttatgaacgaatgggcttcaccgctgaacaatcgtattactattat
catatttggccgggcaaggaggcgaaataa

DBGET integrated database retrieval system