KEGG   Bacillus subtilis subsp. subtilis 168: BSU37890
Entry
BSU37890          CDS       T00010                                 

Gene name
spsC
Definition
(RefSeq) spore coat polysaccharide biosynthesis protein SpsC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_5 OKR_DC_1
Other DBs
NCBI-GeneID: 937234
NCBI-ProteinID: NP_391668
Pasteur: BG10611
BSORF: BG10611
UniProt: P39623 A0A6M3ZHK1
Position
complement(3889732..3890901)
AA seq 389 aa
MVQKRNHFLPYSLPLIGKEEIQEVTETLESGWLSKGPKVQQFEKEFAAFVGAKHAVAVNS
CTAALFLALKAKGIGPGDEVITSPLTFSSTANTIIHTGATPVFADIDENTLNIDPVKLEA
AVTPRTKAVVPVHFGGQSCDMDAILAVAQNHGLFVLEDAAHAVYTTYKQRMIGSIGDATA
FSFYATKNLATGEGGMLTTDDEELADKIRVLSLHGMSKAAWNRYSSNGSWYYEVESPGYK
MNMFDLQAALGLHQLKRLDDMQKRREEIAGRYQTAFQQIPGLITPFVHDDGRHAWHLYVL
QVDEKKAGVTRSEMITALKDEYNIGTSVHFIPVHIHPYYQKQFGYKEADFPNAMNYYKRT
LSLPLYPSMSDDDVDDVIEAVRDIVKGAD
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggtgcaaaagagaaatcattttctcccttactcattgccgttaatcggtaaggaagaa
attcaggaggttacagaaacgcttgaatcgggatggctctctaaaggcccgaaggttcag
cagtttgaaaaagagtttgccgcgtttgtcggggcgaagcacgccgtggcggtgaattca
tgtaccgcagctttatttttggctttgaaagcaaaagggattgggcccggggacgaggtc
attacctctccgcttacgttcagctcgaccgccaatacgattattcatacgggagcgacg
cctgtgtttgcggatattgacgaaaacacgctcaatattgacccggtaaagcttgaggcg
gccgtcacaccgcgaacgaaagcagttgtgcccgtccactttggcgggcagtcctgcgat
atggatgcaatattggctgttgcccaaaatcatggtttattcgtgctggaggatgcggca
catgcggtatatacgacttataagcaaagaatgatcggttctatcggggatgcaacggca
ttcagcttttacgccaccaaaaacctcgcgacaggggaaggcggcatgctgacgactgat
gatgaggagcttgccgataagatacgggtgctaagccttcacggcatgagtaaagccgca
tggaaccgttattcttcaaatggcagctggtactatgaagtcgaatcgcccggctataag
atgaatatgtttgatttgcaggcggccctcggacttcatcagctgaaacggctggatgat
atgcagaaacggagagaagagattgccggccgctatcaaaccgcttttcagcagattcct
gggctgatcacgccgtttgtccatgatgacggcaggcacgcctggcatctatatgttctg
caagttgatgaaaaaaaggccggggttacgcgcagcgaaatgattacggctttaaaggat
gaatacaatatcggcactagcgttcattttattccagtacacattcatccgtattatcaa
aagcaatttggatataaggaagcggactttccgaatgccatgaattactataaacgaacc
ctttctctcccgctctatccatcaatgtctgacgatgatgtagatgatgtcattgaagct
gtgcgggatatcgtaaaaggggctgattaa

DBGET integrated database retrieval system