KEGG   Bacillus subtilis subsp. subtilis 168: BSU37900
Entry
BSU37900          CDS       T00010                                 

Gene name
spsB
Definition
(RefSeq) spore coat polysaccharide biosynthesis protein SpsB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyphos_transf Capsule_synth Epimerase_2 LpxB A-2_8-polyST
Other DBs
NCBI-GeneID: 937239
NCBI-ProteinID: NP_391669
Pasteur: BG10610
BSORF: BG10610
UniProt: P39622 A0A6M4JQG6
Position
complement(3890922..3892346)
AA seq 474 aa
MSAYLSNYWVLYRKYVELFDKLRYKGIPLGLISNFYQYISPELRVMMEEEPELFGSVDQH
IDEGQIQPFFEERIQNIVKTNDEPVKGKVILHFDYLRFSNENYYQFDPEKTAVLARWSLP
HYCDLPVISKREIADSCQKGDSKQYLETACSLLAPYDDHPAFGDQAFRDRLFKDIPLFIE
AIDTVDALFEQEKISAVIVGTAEDIYSRVLALMCQRKGAVSICLQHGALMGDEAFIPVFT
TYQAVFGAYEAEWFIRKGCKPEQILVTGHPRFDQIFNRTPMDMSIFYRKLAFQPTKKIVL
IATQPFSEDFYSGVLQGLSDQKQLQIIIKPHPWEIGKNKLDLYHEAAKKHQACRVIKKEL
ELYDLLPYVDAAVTQTSTVGLEAMLFQKPVLIGKSSGNRSYPYYESLGDFMFDQPDELAH
TLVEVLRSPDVHQKAEEARLAFIAANYPVAESTNALFAELKAKTGVDYRREDTE
NT seq 1425 nt   +upstreamnt  +downstreamnt
ttgtcggcctatttaagcaattattgggtgctgtaccggaagtacgtggagctttttgac
aaacttcgctacaaagggattccgcttgggcttatcagtaatttttatcaatacatcagc
cctgaactgagggtgatgatggaagaagaaccggaattattcggatcggtggatcagcat
atcgatgagggacagattcagccgttttttgaagaaagaatccaaaacatcgttaaaaca
aatgacgaacctgttaaagggaaagtcattttgcactttgattacctgcgtttttcaaac
gaaaattactatcaatttgatcctgaaaaaacggctgttttggccagatggagtttgccg
cattattgtgatctgcctgtaattagcaagcgggagattgcggattcatgccaaaaaggc
gattcgaagcagtatctcgaaacagcctgttcgcttctcgccccttatgatgatcacccg
gcatttggtgatcaagcgtttcgcgaccggcttttcaaagatattcctttatttatagag
gccattgatacagttgatgcgctgtttgaacaggaaaagatttcagctgttattgtcgga
acggcagaagacatttacagcagggtgctcgctctcatgtgtcaaagaaaaggggccgtc
agcatttgtcttcagcatggcgcattgatgggagatgaagccttcattcctgtttttaca
acctatcaagctgtttttggtgcgtatgaagcagagtggttcatacgaaaaggctgtaaa
cccgagcagattctcgtaacgggacatccccgcttcgatcagatttttaacagaacgcct
atggatatgtccatattctatcgaaaacttgcttttcagccgactaaaaaaattgtgctc
attgccactcagcccttttcagaagacttttattccggtgtgctgcaggggctttctgat
cagaagcagctgcaaatcattatcaaaccccacccgtgggaaatcggaaaaaacaagctt
gatctgtatcacgaggcggcgaaaaaacatcaagcatgcagagtcatcaaaaaggagctg
gagctttatgatttgctgccgtatgttgatgccgcagtgacgcaaacctcgacagtcggt
cttgaagccatgctgtttcaaaagcctgtgctgataggaaaatcgtccggaaatcgctcg
tatccgtattatgagtctcttggcgattttatgtttgaccagccggatgaactggcgcac
accttggttgaggttcttcgaagtcccgacgtgcatcaaaaagcagaagaggcgcgcctg
gcattcatagcggctaattatccggtggcagaatcaacaaatgctttatttgcggaactg
aaagccaaaacaggggttgattacaggcgggaagatactgaataa

DBGET integrated database retrieval system