KEGG   Bacillus subtilis subsp. subtilis 168: BSU37910
Entry
BSU37910          CDS       T00010                                 

Symbol
spsA
Name
(RefSeq) spore coat polysaccharide biosynthesis protein SpsA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 937253
NCBI-ProteinID: NP_391670
Pasteur: BG10609
BSORF: BG10609
UniProt: P39621 A0A6M3ZK66
Structure
PDB: 
1QGQ 1QG8 1H7L 1QGS 1H7Q

Position
complement(3892351..3893121)
AA seq 256 aa
MPKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRF
YQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEK
AVIYSASKTYHLNENRDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYW
DESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITDQSIHFQLFELEKNEFVRNLPPQ
RNCRELRESLKKLGMG
NT seq 771 nt   +upstreamnt  +downstreamnt
ttgcctaaagtatcagtcattatgacgagctataacaaaagcgattatgtggcaaagtcc
atttctagcatactctcacaaacgttttcagattttgaattgtttattatggatgacaac
tccaatgaagagacgctgaatgtaatccgtccttttttgaatgataaccgagtgcgtttt
tatcaaagcgatatatctggagtgaaggaaagaacagaaaaaacgagatacgcggcactg
atcaatcaggcgattgagatggcggagggtgaatatatcacctatgcgacggatgacaac
atctatatgccggaccgcctcctgaaaatggtgcgggagctcgatacccatcctgaaaag
gctgtgatttactcagcctccaaaacctatcatttaaacgagaatcgtgacattgtaaaa
gaaactgtcaggcctgccgctcaagtgacatggaacgcgccgtgcgcaattgatcattgc
tcggtgatgcacaggtattcggtgcttgagaaggtaaaggagaagtttggctcctattgg
gatgaaagcccggcgttttaccgtataggagatgcccggttcttttggagagtcaatcat
ttttatccgttttacccactggatgaggagctggacctgaattatattaccgaccaatcg
attcactttcagctgtttgaattagaaaaaaatgaatttgtcaggaaccttcctccgcag
cgaaattgccgagagctgcgtgaatcattaaaaaagcttggaatggggtga

DBGET integrated database retrieval system