KEGG   Bacillus subtilis subsp. subtilis 168: BSU37920
Entry
BSU37920          CDS       T00010                                 

Symbol
ywdL
Name
(RefSeq) spore coat protein GerQ
  KO
K06305  spore germination protein Q
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU37920 (ywdL)
SSDB
Motif
Pfam: Spore_GerQ
Other DBs
NCBI-GeneID: 937241
NCBI-ProteinID: NP_391671
Pasteur: BG10608
BSORF: BG10608
UniProt: P39620 A0A6M3ZHV6
Position
3893441..3893986
AA seq 181 aa
MKPKKNQYQQMQAFDNMQGYQPQFGANPYPQQGQGSQMQTMGMQPMMPMQQGQQGQQGQQ
GFGFPGQQQGGGFQIPSGPTPSGPGQSVPGMLPVEESYIENILRLNRGKTATIYMTFENS
KEWGSKIFRGVIEAAGRDHIIISDPKSGTRYLLLTIYLDYITFDEEIAYTYPYSMASYSP
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaaaccgaaaaaaaatcaatatcagcaaatgcaggcatttgataatatgcaggggtat
cagcctcagtttggcgccaacccgtacccgcagcaaggccaaggctcacaaatgcagaca
atggggatgcagccaatgatgccaatgcagcagggacagcaaggacaacaaggacagcag
ggatttggattcccgggccagcagcagggcggcggttttcaaattccatcggggcctaca
ccgtcaggaccgggccaaagcgttcccggcatgctgcctgttgaggaatcttacatcgag
aatattttgcgcctgaatcggggaaaaacggccaccatttatatgacatttgaaaacagc
aaggaatggggctcgaagatttttcgcggcgtcatcgaagctgcgggccgggatcacatt
attatcagcgacccgaaatcaggaacacgctacctgctcctgacaatctacctcgattac
attacatttgatgaagaaattgcttatacgtatccatattccatggcgtcctattcgcca
agataa

DBGET integrated database retrieval system