KEGG   Bacillus subtilis subsp. subtilis 168: BSU37930
Entry
BSU37930          CDS       T00010                                 

Gene name
ywdK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF423 DUF3917
Other DBs
NCBI-GeneID: 937242
NCBI-ProteinID: NP_391672
Pasteur: BG10607
BSORF: BG10607
UniProt: P39619 A0A6M4JQH9
Position
complement(3894030..3894401)
AA seq 123 aa
MKVFIILGAINALLAVGLGAFGAHGLEGKIPDKYLQVWHTGVQYHMYHALGLFVVAFLAD
KLSGIGSVTTAGWLMFAGIVLFSGSLYILSVTQISILGAITPLGGVAFIISWIMIVVAAV
KYL
NT seq 372 nt   +upstreamnt  +downstreamnt
atgaaagtttttatcatattaggggccattaacgccctgcttgccgtgggactcggagca
ttcggcgctcacggattagaagggaaaatacctgataagtatcttcaggtttggcacaca
ggcgtgcagtatcatatgtatcacgcccttgggttattcgttgtcgcgtttctggctgat
aaattatccggcataggcagtgtcacgacagccggctggctgatgtttgcgggaattgtg
ctgttttccggaagcttatatattctaagtgtgacgcaaatctccattcttggagcgatc
accccgctcggcggtgtggcgtttattatttcttggattatgatcgttgtcgcagccgtc
aaatatctataa

DBGET integrated database retrieval system