KEGG   Bacillus subtilis subsp. subtilis 168: BSU37940
Entry
BSU37940          CDS       T00010                                 

Gene name
ywdJ
Definition
(RefSeq) purine permease YwdJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Xan_ur_permease DUF2301
Other DBs
NCBI-GeneID: 937261
NCBI-ProteinID: NP_391673
Pasteur: BG10606
BSORF: BG10606
UniProt: P39618 A0A6M3ZIB4
Position
complement(3894463..3895785)
AA seq 440 aa
MKLVLGALQWTAFIIAAAIVVPVAVAQSFHLDHSDSARLIQSTFFVLGIAAVIQCLKGHR
LPINESPAGLWWGVYTIYAGLTGTVFATYGDTLRGLQGALLVSAVCFFLLSVFKVIDRLA
KLFTPVVTGVYLLLLVMQLSQPIIKGILGIGYRQDGVDGLVFGLALVVIAAAFIMTNSNI
MFFKQYSILLALFGGWVLFAAAGAAKPIEMPDRLFQLPSLFPFGTPLFNSGLIITSIFIT
ILLIVNMLASMKVVDIAMKKFSKQPDGKHHERHAGFAASFSHLLSGLTGAIAPVPISGAA
GFIETTKMPSKKPFMLGSILVIVISVIPFFMNTFASLPSPVGFAVNFVVFSAMGGLAFAE
FDSYEKEESKRVRSIIGISLLTGVGIMFVPETALKGLHPVFISLLSNGLVLGTLAAIAAD
QFQLWRRRKSDNLVSTENKH
NT seq 1323 nt   +upstreamnt  +downstreamnt
gtgaaattggttcttggcgcgctgcaatggacagcgtttattattgctgcggcgattgtt
gttccggtggcggttgcccagtcgtttcatctggatcactcagattctgcaagattgatt
caaagcactttttttgtactgggaattgccgccgtcattcagtgtttgaaaggccacaga
ctgccgatcaatgaaagcccagccggcttgtggtggggagtgtatacgatttacgcaggg
ctgacgggaactgtgtttgcgacatatggagacacactgcggggtttgcagggagctctt
cttgtaagcgctgtatgtttctttttgttaagtgttttcaaggtcattgacagacttgca
aaattgtttactccggttgtaacgggcgtctatttattgcttcttgtcatgcagctgagt
cagcccattataaaaggaattctcggaatcggttatcgacaggacggggtggacggtctt
gtatttggcctggcgcttgttgtgatcgctgccgcttttataatgacaaattcgaacatc
atgttttttaagcaatattctattttattagccttgttcggcgggtgggtgctgtttgcg
gctgccggagccgcaaagccgattgaaatgccggaccggctgtttcagctgccttccctg
tttccttttgggaccccgttatttaacagcggcctgatcatcacttctatttttattacc
atcttgctgatcgtgaatatgctggcgagcatgaaggtcgtggacatcgccatgaaaaaa
ttcagcaaacagcctgatggaaagcatcatgaacgccatgccggttttgcagcttcattc
agccatctgcttagcggtttgacgggagctattgcgcctgttccgatttcgggagccgca
ggttttattgaaacgaccaagatgccttctaaaaaaccgtttatgctcggcagtattctg
gttatcgtgatcagcgtgatcccgttttttatgaatacgtttgcgagcctgccgtcaccc
gttggatttgcggtgaattttgttgtgttctccgcaatgggcggtctggcctttgccgaa
tttgattcatatgagaaagaagaatcaaaaagggtgaggtctatcatcggtatctcactg
ctgacaggggtcggtatcatgtttgttcctgaaactgcgttaaagggattgcatccggta
tttatttctctattaagcaacgggctcgtattagggacgcttgctgcaatagcagctgac
cagttccagctttggcgcaggagaaaatccgacaatctcgtgtcaacggagaacaaacat
tga

DBGET integrated database retrieval system