KEGG   Bacillus subtilis subsp. subtilis 168: BSU37950
Entry
BSU37950          CDS       T00010                                 

Gene name
ywdI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5327 Bombinin
Other DBs
NCBI-GeneID: 937251
NCBI-ProteinID: NP_391674
Pasteur: BG10605
BSORF: BG10605
UniProt: P39617 A0A6M3ZH76
Position
complement(3895805..3896161)
AA seq 118 aa
MQEDNIYFFGGCFMNIHISALIQKMEEELKKAKTAERDEELKRYVAVVRSLCDVVLDQPE
NASAPRIQPSVTPSPAAPPSTDQLMMEKMMGSAGLNKYRKQEKEKQEEDGNGESLFDF
NT seq 357 nt   +upstreamnt  +downstreamnt
atgcaggaagacaacatttatttttttggagggtgcttcatgaacattcatatatctgct
ttgattcaaaagatggaagaagagctaaaaaaagcaaaaacggctgaacgggatgaggag
ctgaagcgttatgtagcggttgtccgttctctgtgtgatgtcgtgcttgatcagccggag
aacgcgagcgcgccccgcatacagccgagcgttacgccaagtcccgccgcgccgccatcg
acagaccagctgatgatggaaaaaatgatggggagcgcgggattaaacaaatatcgaaag
caagaaaaagagaagcaggaagaggatggaaacggagagtctttatttgatttttaa

DBGET integrated database retrieval system