KEGG   Bacillus subtilis subsp. subtilis 168: BSU37970
Entry
BSU37970          CDS       T00010                                 

Symbol
ung
Name
(RefSeq) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU37970 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU37970 (ung)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BSU37970 (ung)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BSU37970 (ung)
 Prokaryotic type
     BSU37970 (ung)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 937265
NCBI-ProteinID: NP_391676
Pasteur: BG10603
BSORF: BG10603
UniProt: P39615 A0A6M3ZHQ1
Structure
PDB: 
3ZOQ 3ZOR

Position
complement(3897685..3898362)
AA seq 225 aa
MKQLLQDSWWNQLKEEFEKPYYQELREMLKREYAEQTIYPDSRDIFNALHYTSYDDVKVV
ILGQDPYHGPGQAQGLSFSVKPGVKQPPSLKNIFLELQQDIGCSIPNHGSLVSWAKQGVL
LLNTVLTVRRGQANSHKGKGWERLTDRIIDVLSERERPVIFILWGRHAQMKKERIDTSKH
FIIESTHPSPFSARNGFFGSRPFSRANAYLEKMGEAPIDWCIKDL
NT seq 678 nt   +upstreamnt  +downstreamnt
ttgaaacagcttttacaagacagctggtggaatcagctaaaggaagagtttgagaaaccg
tattatcaagagctcagagagatgctgaagagggaatacgcggagcaaacgatttatccg
gacagccgggatattttcaacgcgctgcattatacatcatatgatgatgtcaaggtcgtc
attttgggtcaagatccgtatcacgggccgggacaggctcaaggtttaagcttctctgtc
aagcccggtgtaaagcagccgccttcgttaaaaaatatctttcttgagctgcagcaggac
atcgggtgcagcatcccgaatcacgggtcgcttgtgagctgggcaaagcaaggcgttctt
ttgctgaatactgtgctgacagtaaggcgcggacaggcgaattcccataagggaaaaggc
tgggagcgactgacggaccgaattattgacgtgctgagtgaaagagagcggccggttatc
tttattttgtggggacggcatgctcaaatgaaaaaagaacggatcgacacctccaagcat
tttatcattgaatcgacgcatcccagcccgttttctgcgagaaacggatttttcgggagc
agaccgttttcccgggcgaatgcctatttggagaaaatgggagaggcgccgattgattgg
tgtattaaggatttgtaa

DBGET integrated database retrieval system