KEGG   Bacillus subtilis subsp. subtilis 168: BSU37980
Entry
BSU37980          CDS       T00010                                 

Gene name
ywdF
Definition
(RefSeq) glycosyltransferase YwdF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_transf_64 Glyco_transf_21
Other DBs
NCBI-GeneID: 937259
NCBI-ProteinID: NP_391677
Pasteur: BG10602
BSORF: BG10602
UniProt: P39614 A0A6M4JQD6
Position
complement(3898376..3899182)
AA seq 268 aa
MKISIVIVTYNRIPALCELLESISRQTLMPYEIIIVNDAGESVVPVKALYPELPIAVINL
EKNSGHVAARNAGVKEASGDCIMLCDDDDFFTPGHIEKMAKEIETADFVHSDAEIVSFEE
KNGTRYPVSRKLFAYTADYEDMRVFSTYVPSGSMYRRFLHDEIGYFDADVHNYWDWDFYL
RAAKDYRVKRVPCASVIYAFSDAGDNQSADLGAKRKQYLDRLSEKHGLGELPTKNFAVLL
EEPEMKRREAKSEMVWDGEPVYSRLHRS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgaagatttctatcgtaattgtgacctataatcggattccggctttgtgtgagcttttg
gagtcgatttcccgccagaccttgatgccgtatgaaattattattgtgaatgatgccggg
gaatcggtcgtgccggtcaaagcactttatccggagctgccgattgctgtcatcaattta
gaaaagaactcggggcatgtggctgcgagaaatgccggtgtaaaagaggcgtctggggat
tgcattatgctgtgtgatgacgatgatttctttacgccagggcatatcgagaaaatggca
aaggaaatagaaacggcagacttcgttcattctgatgcggaaatagtttcgtttgaagag
aaaaacggaacaaggtatccagtgtcacggaaattgtttgcttataccgctgactatgag
gatatgagagtgttttctacatacgtgccgtcgggcagcatgtacagacgttttctgcat
gatgaaatcgggtatttcgatgctgatgtgcacaattactgggactgggatttttatttg
cgcgcggccaaggattaccgggtgaagcgtgtcccttgcgccagcgtgatttatgccttc
agtgacgcgggagacaatcagtctgctgaccttggcgccaagcggaagcaatatttggat
cgtttaagtgaaaagcacggactcggggagctgccgacgaaaaactttgccgtcctgctt
gaagagcctgagatgaagaggcgggaagcaaaaagtgaaatggtttgggatggcgagcct
gtctattccagacttcatcgttcgtaa

DBGET integrated database retrieval system