KEGG   Bacillus subtilis subsp. subtilis 168: BSU37990
Entry
BSU37990          CDS       T00010                                 

Gene name
ywdE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937260
NCBI-ProteinID: NP_391678
Pasteur: BG10601
BSORF: BG10601
UniProt: P39613 A0A6M4JQF9
Position
complement(3899272..3899805)
AA seq 177 aa
MRISSCLYGFVAHGAVFLFTGGCMLLAMAASLPFVFLLDRLPDVVFTAGAILTLLCSYAY
VWFWAVRFAYNQKMRLFEVQLGSFVLLALMISLFLLDGSSMKDIMMNWDDAGCAFVPPAF
TFLCLSYALVLLPVYQSKLWRLILPNGVRMKDIFHVFGDLMLIMVLLIGATLLFLSL
NT seq 534 nt   +upstreamnt  +downstreamnt
gtgaggattagctcttgtttatatggttttgtagctcatggggcagtatttttgtttact
ggtggctgcatgctcttggctatggcagccagcttgccttttgtttttctgcttgatcgg
ctgcctgatgtcgtctttacagcaggtgccattcttacgctgctatgttcatatgcttat
gtctggttttgggcggtccgatttgcatataaccagaaaatgcgcctgtttgaggttcaa
ttggggtcctttgtgttgctagccctcatgatatctttgtttttattggatggatctagt
atgaaagacatcatgatgaattgggacgatgcaggctgtgcttttgtgccgccggctttt
acatttttgtgtctttcttatgcactggtgctgctgccggtctatcaatctaagctgtgg
cgtcttatccttccgaatggcgtccgcatgaaagatatctttcatgtctttggagatctg
atgctgatcatggtgcttctgatcggagccactttgctgtttctatcattgtag

DBGET integrated database retrieval system