KEGG   Bacillus subtilis subsp. subtilis 168: BSU38000
Entry
BSU38000          CDS       T00010                                 

Symbol
ywdD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1700 DUF6442
Other DBs
NCBI-GeneID: 937267
NCBI-ProteinID: NP_391679
Pasteur: BG10600
BSORF: BG10600
UniProt: P39612 A0A6M4JQH7
Position
complement(3899853..3900488)
AA seq 211 aa
MDKETYVSEIKSGLKGLPEGEAMIEEIESHIEHHLFRSFQEGKSEEEAMQTLLQAFGTPT
DIVSSFKKIQPVTFRAFLMFHLFCNSALFAVGIAITIMHVWLESPFVQAVWKGISVSVWL
ILAAYMIYWVLIGYQGVKEFGKRGEKLVLHTILISMVPNVIFMLVFLFNVIPAALFQSLL
TPWFVGTCAFATLLFPLFGRMGCYIGRRQLV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggataaagaaacatatgtatccgaaatcaaaagcgggcttaaagggcttcctgagggt
gaggcgatgatagaagagattgagagccatattgaacatcatctgtttcgctcttttcag
gaaggaaagagtgaggaggaagctatgcagactttattgcaggcgtttggaacaccaact
gacattgtttcttcgtttaagaaaatacagccagtaacgtttcgtgcgtttttgatgttc
catcttttctgtaacagtgccctattcgctgtcggcattgcgattacaataatgcatgta
tggcttgaatcaccgtttgttcaagcagtatggaaaggcatttctgtttctgtttggctg
atcttagctgcatatatgatctactgggtgctgattgggtatcaaggcgtgaaggagttt
ggaaaacgcggagaaaagcttgttctacatacgattctgatctcaatggtgccaaacgtc
atttttatgcttgtttttctattcaatgtaattcctgctgcgctgtttcaatccttgttg
acaccttggtttgttggaacttgtgcttttgcaacgctgttatttccgttatttggccga
atgggctgttatattggcaggcgtcagcttgtctga

DBGET integrated database retrieval system