KEGG   Bacillus subtilis subsp. subtilis 168: BSU38018
Entry
BSU38018          CDS       T00010                                 

Symbol
ywzG
Name
(RefSeq) DNA-binding protein YwzG
  KO
K10947  PadR family transcriptional regulator, regulatory protein PadR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU38018 (ywzG)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU38018 (ywzG)
SSDB
Motif
Pfam: PadR HTH_34 DUF505 DUF3116 HxlR DUF4364 MAGE HTH_27
Other DBs
NCBI-GeneID: 8303176
NCBI-ProteinID: YP_003097793
UniProt: C0H3S6 A0A6M3ZK73
Position
complement(3900481..3900819)
AA seq 112 aa
MLNRELVKGSTVILVLTLLNERPMYGYELVKEMGSRSGNELQMKEGTLYPSLHKLERQGY
ISSYWEKQEKGPDRKYYRITDEGKEVLAERTKEWSVFSAMMDRILKWSGQNG
NT seq 339 nt   +upstreamnt  +downstreamnt
atgttaaatcgtgagctggttaagggaagcacggttatattggtattgacgcttctgaac
gagcggccgatgtacggctatgagcttgtaaaagaaatgggaagccgcagcggaaatgaa
ctgcagatgaaagaagggaccttgtatccttctcttcacaagcttgaacgccaagggtat
atttcttcctactgggagaagcaggagaaaggaccggaccgcaaatattaccggattaca
gacgagggcaaagaagtgctggcggaacgcacgaaggaatggagcgtattttcagccatg
atggaccgaatactgaagtggagcggacaaaatggataa

DBGET integrated database retrieval system