KEGG   Bacillus subtilis subsp. subtilis 168: BSU38020
Entry
BSU38020          CDS       T00010                                 

Gene name
thiD
Definition
(RefSeq) pyridoxine kinase
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00750  Vitamin B6 metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSU38020 (thiD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     BSU38020 (thiD)
SSDB
Motif
Pfam: Phos_pyr_kin PfkB HK
Other DBs
NCBI-GeneID: 937262
NCBI-ProteinID: NP_391681
Pasteur: BG10598
BSORF: BG10598
UniProt: P39610 A0A6M4JQD5
Structure
PDB: 
2I5B

Position
3900963..3901778
AA seq 271 aa
MSMHKALTIAGSDSSGGAGIQADLKTFQEKNVYGMTALTVIVAMDPNNSWNHQVFPIDTD
TIRAQLATITDGIGVDAMKTGMLPTVDIIELAAKTIKEKQLKNVVIDPVMVCKGANEVLY
PEHAQALREQLAPLATVITPNLFEASQLSGMDELKTVDDMIEAAKKIHALGAQYVVITGG
GKLKHEKAVDVLYDGETAEVLESEMIDTPYTHGAGCTFSAAVTAELAKGAEVKEAIYAAK
EFITAAIKESFPLNQYVGPTKHSALRLNQQS
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtctatgcataaagcactcaccattgccggctcagattccagcggcggtgctgggatt
caagctgatttaaaaacatttcaagaaaaaaacgtatacgggatgaccgccttaacggtg
atcgttgcgatggacccaaacaacagctggaaccatcaggtattcccgatcgatactgat
acaatccgcgcccagcttgcaacaattacggacggcatcggcgtggacgccatgaaaaca
ggaatgctgccaaccgttgacattatcgagcttgcggcaaaaacgatcaaagaaaaacaa
ttaaaaaatgtggtaattgacccggttatggtttgcaaaggtgctaatgaagtcctttat
ccggagcacgcccaagccctgcgtgagcaattggctccgctagccactgtcattacgcca
aacttgtttgaagccagccagctcagcggcatggatgaactaaaaacagttgacgatatg
atcgaagccgcgaaaaaaattcacgcactcggcgctcaatatgtcgtcattacaggcgga
ggcaaactcaaacacgagaaagccgttgatgttctctatgacggagaaacagcggaagtc
cttgaaagcgaaatgatcgatacgccttatacacatggcgcaggctgtacattctcagca
gccgtgacagcggagcttgccaaaggtgcggaagtcaaagaagccatttacgcagcgaaa
gaattcatcacagcggccattaaagaatccttcccgctaaaccagtatgttggtcctacg
aagcattctgcactgcgcctgaatcaacaatcataa

DBGET integrated database retrieval system