KEGG   Bacillus subtilis subsp. subtilis 168: BSU38030
Entry
BSU38030          CDS       T00010                                 

Gene name
ywdA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: WXG100
Other DBs
NCBI-GeneID: 937276
NCBI-ProteinID: NP_391682
Pasteur: BG10597
BSORF: BG10597
UniProt: P39609 A0A6M3ZLI9
Position
complement(3901868..3902116)
AA seq 82 aa
MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKE
YALFVQSIETFLRKSANNLKIK
NT seq 249 nt   +upstreamnt  +downstreamnt
ttgaatatacatgaacagaagataacaccggaatgtttggaaaaggctgctaaccaagtt
gaagataagcgagaagaatataaggatgtgctgcttcagctgaaaaaaatgcttggcgga
acaacgccgcacagtgaaacggcggaaattctcacgcgggcatatgaacaaatgaaggaa
tatgcactttttgttcagtcgatagaaacatttttgaggaaatctgcaaacaatttaaaa
atcaaataa

DBGET integrated database retrieval system