KEGG   Bacillus subtilis subsp. subtilis 168: BSU38040Help
Entry
BSU38040          CDS       T00010                                 

Gene name
sacA
Definition
(RefSeq) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
bsu00500  Starch and sucrose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSU38040 (sacA)
   00500 Starch and sucrose metabolism
    BSU38040 (sacA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BSU38040 (sacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 BNR_2
Motif
Other DBs
NCBI-GeneID: 937277
NCBI-ProteinID: NP_391683
Pasteur: BG10596
BSORF: BG10596
UniProt: P07819
Position
complement(3902210..3903649)
Genome map
AA seq 479 aa AA seqDB search
MTAHDQELRRRAYEEVEKKEPIANSDPHRQHFHIMPPVGLLNDPNGVIYWKGSYHVFFQW
QPFQTGHGAKFWGHYTTQDVVNWKREEIALAPSDWFDKNGCYSGSAVTKDDRLYLFYTGN
VRDQDGNRETYQCLAVSDDGLSFEKKGVVARLPEGYTAHFRDPKVWEHEGTWYMVIGAQT
ENLKGQAVLFASDNLTEWRFLGPITGAGFNGLDDFGYMWECPDLFSLQGSDVLIVSPQGL
EADGFRYQNVYQSGYFVGRLDYNKPELKHGEFTELDQGFDFYAPQTLEDDQGRRILFAWM
AVPDQDEGSHPTIDCHWIHCMTLPRQLTLSGQKLIQQPLPELKAMRRNEKKIHINMHGSS
GALPVEKPERTEILLEDIHTESGFSISIRGTATFSFHKDEGIVTLERKSFDGKRTEARHC
RIKDLHTVHMFLDASSVEIFINNGEEVLSARYFPFPGNHEVTASATGKSEMNVGIWTLM
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacatgaccaggagcttcgtcgccgggcttatgaagaagtggagaaaaaagag
cccatcgctaacagcgatccgcaccgccagcattttcatatcatgccgccggttgggctg
ctgaatgacccgaatggcgtgatttattggaagggcagctatcatgtattctttcagtgg
cagccgtttcagacggggcacggcgcaaaattttgggggcattatacgacacaggatgtt
gtgaattggaagcgggaagagattgcgctggctccgagtgattggtttgataaaaacggc
tgctactcgggcagcgctgtcacgaaagacgatcggctctatcttttttacacaggaaat
gtcagggatcaggatggaaatcgggaaacgtatcaatgccttgctgtttctgacgacggg
ctgtcctttgagaaaaagggtgtcgtcgcccgccttccggaaggatatacggcgcatttt
cgcgatccgaaggtatgggagcatgaaggcacatggtatatggtgattggtgcgcaaaca
gagaatttgaaagggcaggctgtgttgtttgcttctgataacctgacagagtggagattt
cttggcccgataaccggcgcgggcttcaacgggctggacgattttggatacatgtgggaa
tgccctgatttgttttcccttcaaggatcggatgtgctgattgtttcgcctcaagggctt
gaggctgacggtttccgttatcagaacgtatatcaatcaggttattttgtcggccgcctc
gattataacaagcctgaactgaagcatggtgaatttacggagcttgatcaaggttttgat
ttttacgcgccgcaaacacttgaagacgatcagggaaggcggattttatttgcatggatg
gcggtgcctgatcaggatgaagggtcccatccgaccattgactgccactggattcactgc
atgacgctgccgagacagctgacgctttcaggacagaagctgattcagcagccgctgcct
gagctaaaagccatgcgcagaaatgagaaaaaaatacacatcaacatgcatggatcatct
ggtgcgcttccagtggaaaaacctgaaagaactgagattctactggaagacattcatacg
gagtctggcttttcaatcagtatccgcggaacggctacgttttccttccataaagacgag
gggattgttacgctggaacgaaagagctttgacggaaaaagaacagaagcgagacattgc
cgcatcaaggatttgcataccgtacacatgtttctcgacgcgtcatctgtggaaatcttt
atcaataacggagaagaggtcttgagtgcaagatattttcctttcccgggaaatcatgaa
gtaacagccagtgcgaccgggaaatctgaaatgaatgtcggaatttggacacttatgtag

DBGET integrated database retrieval system