KEGG   Bacillus subtilis subsp. subtilis 168: BSU38050
Entry
BSU38050          CDS       T00010                                 

Gene name
sacP
Definition
(RefSeq) PTS system-sucrose-specific transporter subunit EIIBC
  KO
K02810  sucrose PTS system EIIBCA or EIIBC component [EC:2.7.1.211]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU38050 (sacP)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU38050 (sacP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38050 (sacP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.211  protein-Npi-phosphohistidine---sucrose phosphotransferase
     BSU38050 (sacP)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sucrose-specific II component
    BSU38050 (sacP)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIB DUF3800
Other DBs
NCBI-GeneID: 937266
NCBI-ProteinID: NP_391684
Pasteur: BG10595
BSORF: BG10595
UniProt: P05306 A0A6M4JQE9
Position
complement(3903646..3905031)
AA seq 461 aa
MDYKETAKRLIELLGGKENIISAAHCATRLRLVMKDESKIDQAQVEELDGVKGAFSSSGQ
YQIIFGTGLVNKVFDAFSKEADIEREEHVNHQDAAKEKLNPAARFAKTLSNIFVPIIPAI
VASGLLMGLLGMINAFHWMSKDSALLQLLDMFSSAAFIFLPILIGVSASKEFGSNPYLGA
VIGGIMIHPNLLNPWGLAEATPDYMHLFGFDIALLGYQGTVIPVLLAVYVMSKVEKWTRK
VVPHAVDLLVTPFVTVIVTGFVAFIAIGPLGRALGSGITVALTYVYDHAGFVAGLIFGGT
YSLIVLTGVHHSFHAIEAGLIADIGKNYLLPIWSMANVAQGGAGLAVFFMAKKAKTKEIA
LPAAFSAFLGITEPVIFGVNLRYRKPFIAAMIGGALGGAYVVFTHVAANAYGLTGIPMIA
IAAPFGFSNLIHYLIGMAIAAVSAFIAAFVMKINEDEERKK
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggattacaaagagactgcaaaacgcctcattgagcttctcggagggaaagaaaatatt
atcagcgcggctcattgtgcaacaagactgcgtttagtgatgaaagatgaatcaaagata
gatcaagcacaagtagaagagcttgatggcgttaaaggggctttcagcagctctggccag
taccagatcattttcggaacaggccttgtgaataaagtattcgatgccttttctaaagaa
gctgatatcgagcgtgaagaacacgtcaatcatcaggatgcggcaaaagaaaagctgaat
cccgctgcgagatttgcgaaaacgctttctaatatttttgttccaatcatcccagctatt
gtagccagcggcctattaatgggattgctgggtatgatcaatgcgtttcattggatgagc
aaggattctgcgcttttgcagctgcttgatatgttttcaagtgcagcattcattttcttg
ccgattctaatcggggtcagcgcttcaaaagagtttggcagcaatccatacttgggagcg
gtcatcgggggaatcatgattcatccgaatcttttaaatccatggggattggcggaagcg
acacctgattacatgcatcttttcggatttgatatcgctcttctcggctaccagggaact
gttatccctgtcctgcttgcggtgtatgtgatgagcaaggtagagaaatggacgagaaaa
gtggttccacatgcggtggatttgcttgttacaccatttgttactgtgattgtcaccggg
tttgttgcttttatcgcgattggccctctaggcagagcgcttggctccggcattacggtt
gctttaacttatgtatatgaccatgccggttttgtcgcaggtctgattttcgggggcacg
tattcactcatcgtgctgacaggcgttcatcacagcttccatgcgattgaggcagggcta
attgcagatataggcaaaaactacttgctgccgatctggtcaatggcgaatgtcgcacag
ggcggggcaggtcttgccgtcttctttatggcgaaaaaggcaaagacaaaagaaatcgcg
cttccggcagcattttccgcttttctcggcattactgagcccgtcatattcggagtcaat
ctgcgctaccgaaaaccgtttatcgccgcgatgatcggaggcgcattgggtggggcatat
gtcgtctttacacatgtagctgcaaacgcttacgggttaacgggaattccgatgatcgcc
attgcggctccgtttggcttcagcaacttgattcactatctgattggcatggcgattgcg
gcagtgtcagcgttcattgcagcatttgtcatgaagattaatgaggatgaggagaggaaa
aaatga

DBGET integrated database retrieval system