KEGG   Bacillus subtilis subsp. subtilis 168: BSU38060
Entry
BSU38060          CDS       T00010                                 

Gene name
ywcJ
Definition
(RefSeq) transporter
  KO
K02598  nitrite transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38060 (ywcJ)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU38060 (ywcJ)
SSDB
Motif
Pfam: Form_Nir_trans Ost5 CCT
Other DBs
NCBI-GeneID: 937283
NCBI-ProteinID: NP_391685
Pasteur: BG10594
BSORF: BG10594
UniProt: P39608 A0A6M4JQF7
Position
3905333..3906103
AA seq 256 aa
METQALQKVEQYALKKQNIFASSKIRYVLRSILASIFIGFGITAASKTGSYFFMADSPFA
FPAAAVTFGAAILMIAYGGGDLFTGNTFYFTYTALRKKISWRDTLYLWMSSYAGNLIGAI
LFAILISATGLFEEPSVHSFLIHLAEHKMEPPASELFFRGMLCNWLVCLAFFIPMSLKGE
GAKLFTMMLFVFCFFISGFEHSIANMCTFAISLLIEHPDTVTLMGAVRNLIPVTLGNLTA
GIVMMGWMYYTLNPDQ
NT seq 771 nt   +upstreamnt  +downstreamnt
atggaaactcaagcattacaaaaggttgaacagtatgctttgaaaaaacaaaacatattc
gcttcaagcaaaatccgttatgtgcttcggtccattttggccagtatatttattggtttt
ggcattacagccgcaagcaaaacaggcagctatttctttatggctgattctccgtttgcc
tttccggcagccgctgtcactttcggggccgctattctgatgattgcttacggaggcgga
gatttatttaccggcaacaccttttatttcacctataccgcgctccggaaaaaaatcagc
tggcgcgacaccctatacttgtggatgtcaagctatgccggcaatttaatcggcgccatt
ctgtttgccatcctgatcagcgcgacgggactttttgaggagccttctgttcattccttt
ttgattcatttggcagagcacaaaatggagccgccggcttccgaattgtttttcagagga
atgctgtgcaattggcttgtgtgcctcgcctttttcattccaatgtctctcaaaggggaa
ggagcaaagctttttaccatgatgcttttcgttttctgcttctttatttccggctttgaa
cacagcattgccaatatgtgcacattcgccatctcgcttttgatcgagcaccctgataca
gtgacactgatgggagcagtcagaaacttaatccccgttacgctcggcaatctgaccgcg
ggaatagttatgatgggctggatgtactacacactgaatcctgatcaataa

DBGET integrated database retrieval system