KEGG   Bacillus subtilis subsp. subtilis 168: BSU38070
Entry
BSU38070          CDS       T00010                                 

Gene name
sacT
Definition
(RefSeq) SacPA operon antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: PRD CAT_RBD Glyco_hydro_98M
Other DBs
NCBI-GeneID: 937284
NCBI-ProteinID: NP_391686
Pasteur: BG10593
BSORF: BG10593
UniProt: P26212 A0A6M3ZHP4
Position
complement(3906142..3906972)
AA seq 276 aa
MKIYKVLNNNAALIKEDDQEKIVMGPGIAFQKKKNDLIPMNKVEKIFVVRDENEKFKQIL
QTLPEEHIEIAEDIISYAEGELAAPLSDHIHIALSDHLSFAIERIQNGLLVQNKLLHEIK
ALYKKEYEIGLWAIGHVKETLGVSLPEDEAGYIALHIHTAKMDAESMYSALKHTTMIKEM
IEKIKQYFNRKVDENSISYQRLVTHLRYAVSRLESNEALHRMDEEMLYFIQKKYSFAYQC
ALELAEFLKNEYQLHLPESEAGYITLHVQRLQDLSE
NT seq 831 nt   +upstreamnt  +downstreamnt
ttgaaaatctataaagtattaaacaacaatgcggctttaataaaagaggatgatcaggaa
aaaatcgtgatgggaccgggaatcgcttttcaaaaaaagaaaaatgatctcatccctatg
aataaagtggaaaagatctttgtcgtgcgcgacgagaatgaaaagttcaaacaaatcctg
caaacactgccggaggagcatatagaaatagctgaggatatcatcagctatgcggaagga
gagctcgcggcgccgctgagcgatcacattcatatcgcgctttccgaccatttgtccttt
gcgatcgaaaggattcaaaatgggctgcttgtgcagaataaattgctgcatgagataaag
gcgctctataaaaaagaatatgagatcggcctgtgggcgatcggacatgtaaaagagaca
ttgggcgtgtctctgcctgaagatgaagcgggttatattgcccttcacatccatacggcg
aagatggatgcggagagcatgtattcagcgctgaagcatacgaccatgatcaaagaaatg
atagagaaaataaaacaatactttaatcgaaaggtggatgaaaacagcatttcctatcaa
cgccttgtcacgcatttgcgatacgcggtcagccggttggaatcaaatgaagcgctccat
cgtatggacgaggagatgctttatttcatccaaaaaaagtattcattcgcctatcaatgt
gcgctggagctggcggagtttttgaaaaatgaatatcaattacatttgccggaatccgag
gccggctatatcacgctgcatgtccagcgtcttcaagatctctcggaataa

DBGET integrated database retrieval system