KEGG   Bacillus subtilis subsp. subtilis 168: BSU38080
Entry
BSU38080          CDS       T00010                                 

Gene name
ywcI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937275
NCBI-ProteinID: NP_391687
Pasteur: BG10592
BSORF: BG10592
UniProt: P39607 A0A6M3ZHR4
Position
complement(3907012..3907314)
AA seq 100 aa
MKRLLVSLRVWMVFLMNWVTPDRKTAAAAVYSAQRTYQRKAAVQAAGLVSFYEWRMAVNE
EEKQKAKAAALYKRRCLQAFKESPKQERAGPHLYMAVKRR
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaaacgtttgcttgtatctttacgggtgtggatggtctttttgatgaactgggtgacg
ccggacagaaaaactgcggctgccgcggtctattcggctcagcgtacataccaaagaaag
gcggctgtgcaggccgcaggactcgtttcgttttatgaatggcggatggctgtgaatgag
gaagaaaagcagaaagcgaaagccgccgcgctttataaaagaagatgtttgcaagccttc
aaggaatcgccaaagcaggagagagcgggcccgcatctttacatggcggtcaaaaggagg
taa

DBGET integrated database retrieval system