KEGG   Bacillus subtilis subsp. subtilis 168: BSU38090Help
Entry
BSU38090          CDS       T00010                                 

Gene name
vpr
Definition
(RefSeq) minor extracellular protease vpr
  KO
K14647  minor extracellular serine protease Vpr [EC:3.4.21.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU38090 (vpr)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU38090 (vpr)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BSU38090 (vpr)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S8: subtilisin family
   BSU38090 (vpr)
Chaperones and folding catalysts [BR:bsu03110]
 Intramolecular chaperones
  Subtilisin family
   BSU38090 (vpr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 PA Inhibitor_I9 FlgD_ig CHU_C Glyco_hydro_125 YtkA
Motif
Other DBs
NCBI-GeneID: 937291
NCBI-ProteinID: NP_391688
Pasteur: BG10591
BSORF: BG10591
UniProt: P29141
Position
3907844..3910264
Genome map
AA seq 806 aa AA seqDB search
MKKGIIRFLLVSFVLFFALSTGITGVQAAPASSKTSADLEKAEVFGDIDMTTSKKTTVIV
ELKEKSLAEAKEAGESQSKSKLKTARTKAKNKAIKAVKNGKVNREYEQVFSGFSMKLPAN
EIPKLLAVKDVKAVYPNVTYKTDNMKDKDVTISEDAVSPQMDDSAPYIGANDAWDLGYTG
KGIKVAIIDTGVEYNHPDLKKNFGQYKGYDFVDNDYDPKETPTGDPRGEATDHGTHVAGT
VAANGTIKGVAPDATLLAYRVLGPGGSGTTENVIAGVERAVQDGADVMNLSLGNSLNNPD
WATSTALDWAMSEGVVAVTSNGNSGPNGWTVGSPGTSREAISVGATQLPLNEYAVTFGSY
SSAKVMGYNKEDDVKALNNKEVELVEAGIGEAKDFEGKDLTGKVAVVKRGSIAFVDKADN
AKKAGAIGMVVYNNLSGEIEANVPGMSVPTIKLSLEDGEKLVSALKAGETKTTFKLTVSK
ALGEQVADFSSRGPVMDTWMIKPDISAPGVNIVSTIPTHDPDHPYGYGSKQGTSMASPHI
AGAVAVIKQAKPKWSVEQIKAAIMNTAVTLKDSDGEVYPHNAQGAGSARIMNAIKADSLV
SPGSYSYGTFLKENGNETKNETFTIENQSSIRKSYTLEYSFNGSGISTSGTSRVVIPAHQ
TGKATAKVKVNTKKTKAGTYEGTVIVREGGKTVAKVPTLLIVKEPDYPRVTSVSVSEGSV
QGTYQIETYLPAGAEELAFLVYDSNLDFAGQAGIYKNQDKGYQYFDWDGTINGGTKLPAG
EYYLLAYAANKGKSSQVLTEEPFTVE
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaggggatcattcgctttctgcttgtaagtttcgtcttattttttgcgttatcc
acaggcattacgggcgttcaggcagctccggcttcttcaaaaacgtcggctgatctggaa
aaagccgaggtattcggtgatatcgatatgacgacaagcaaaaaaacaaccgttatagtg
gaattaaaagaaaaatccttggcagaagcgaaggaagcgggagaaagccaatcgaaaagc
aagctgaaaaccgctcgcaccaaagcaaaaaacaaagcaatcaaagcagtgaaaaacgga
aaagtaaaccgggaatatgagcaggtattctcaggcttctctatgaagcttccagctaat
gagattccaaaacttctagcggtaaaagacgttaaggcagtgtacccgaacgtcacatat
aaaacagacaatatgaaggataaagacgtcacaatctccgaagacgccgtatctccgcaa
atggatgacagtgcgccttatatcggagcaaacgatgcatgggatttaggctacacagga
aaaggcatcaaggtggcgattattgacactggggttgaatacaatcacccagatctgaag
aaaaactttggacaatataaaggatacgattttgtggacaatgattacgatccaaaagaa
acaccaaccggcgatccgaggggcgaggcaactgaccatggcacacacgtagccggaact
gtggctgcaaacggaacgattaaaggcgtagcgcctgatgccacacttcttgcttatcgt
gtgttagggcctggcggaagcggcacaacggaaaacgtcatcgcgggcgtggaacgtgca
gtgcaggacggggcagatgtgatgaacctgtctctcggaaactctttaaacaacccggac
tgggcgacaagcacagcgcttgactgggccatgtcagaaggcgttgtcgctgttacctca
aacggcaacagcggaccgaacggctggacagtcggatcgccgggcacatcaagagaagcg
atttctgtcggtgcgactcagctgccgctcaatgaatacgccgtcactttcggctcctac
tcttcagcaaaagtgatgggctacaacaaagaggacgacgtcaaagcgctcaataacaaa
gaagttgagcttgtcgaagcgggaatcggcgaagcaaaggattttgaagggaaagacctg
acaggcaaagtcgccgttgtcaaacgaggcagcattgcatttgtggataaagcggataac
gctaaaaaagccggtgcaatcggcatggttgtgtataacaacctctctggagaaattgaa
gccaatgtgccaggcatgtctgtcccaacgattaagctttcattagaagacggcgaaaaa
ctcgtcagcgccctgaaagctggtgagacaaaaacaacattcaagttgacggtctcaaaa
gcgctcggtgaacaagtcgctgatttctcatcacgcggccctgttatggatacgtggatg
attaagcctgatatttccgcgccaggggtcaatatcgtgagcacgatcccaacacacgat
cctgaccatccatacggctacggatcaaaacaaggaacaagcatggcatcgcctcatatt
gccggagcggttgccgttattaaacaagccaaaccaaagtggagcgttgaacagattaaa
gccgccatcatgaataccgctgtcactttaaaggatagcgatggggaagtatatccgcat
aacgctcaaggcgcaggcagcgcaagaattatgaacgcaatcaaagccgattcgctcgtc
tcacctggaagctattcatacggcacgttcttgaaggaaaacggaaacgaaacaaaaaat
gaaacgtttacgattgaaaatcaatcttccattagaaagtcatacacacttgaatactca
tttaatggcagcggcatttccacatccggcacaagccgtgttgtgattccggcacatcaa
accgggaaagccactgcaaaagtaaaggtcaatacgaagaaaacaaaagctggcacctat
gaaggaacggttatcgtcagagaaggcggaaaaacggtcgctaaggtacctacattgctg
attgtgaaagagcccgattatccgagagtcacatctgtctctgtcagcgaagggtctgta
caaggtacctatcaaattgaaacctaccttcctgcgggagcggaagagctggcgttcctc
gtctatgacagcaaccttgatttcgcaggccaagccggcatttataaaaaccaagataaa
ggttaccagtactttgactgggacggcacgattaatggcggaaccaaacttccggccgga
gagtattacttgctcgcatatgccgcgaacaaaggcaagtcaagccaggttttgaccgaa
gaacctttcactgttgaataa

DBGET integrated database retrieval system