KEGG   Bacillus subtilis subsp. subtilis 168: BSU38100
Entry
BSU38100          CDS       T00010                                 

Symbol
ywcH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-GeneID: 937286
NCBI-ProteinID: NP_391689
Pasteur: BG10590
BSORF: BG10590
UniProt: P39606 A0A6M4JQI7
Position
complement(3910302..3911303)
AA seq 333 aa
MVSLSILDQSPVSEGSNAETALQQTVALAQAAEDLGYKRFWVSEHHFSKRLAGSSPEVLI
SHIAAKTKRIRVGSGGVMLPHYSAYKVAENFRVLEGLTPGRIDLGLGRAPGGMPIASWAL
NDGGKRNADQYPQQIKELTMYLHDLADDKHRFPNLTAAPHISTAPDVWLLGSSGESALLA
AESGAGYMFAHFINGEGGEGTVRQYKRRFKPSVLGDTPRAAVAVFVLCADTEEKAEELGA
VLDFTLLAGEQGIPLEGVPSYEAVRKNTYSPYEQRRIADNRNRMIVGTKEQVKERLLALS
NAYETEEIMVVTITHHFEDKLRSYRLLQEAFAD
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggtttcattaagtatattagatcaatctccagtatcagagggcagcaatgcagaaacg
gccttacagcaaaccgttgcgcttgcccaagctgctgaggaccttggatataagagattt
tgggtttctgagcatcacttttcaaaacggctggcagggtccagtcctgaggtgctaatc
agtcatatagcagcgaaaacaaagcgaattcgtgttggatcaggaggagtcatgctgccg
cattacagtgcttataaagtagctgaaaactttcgtgttctggaggggctgacaccagga
agaattgacctggggcttggcagagcaccggggggaatgccgattgcatcatgggcgctg
aatgacggtggtaagcgcaatgctgatcagtatccgcagcaaattaaggagctgaccatg
tatttgcatgatttggcggatgacaaacaccgttttccgaatctgaccgctgcgccgcat
atttcaacggctccggatgtgtggctgctcggctcatctggagaaagcgcgctgctcgca
gctgaatctggcgctggctatatgtttgcccattttatcaatggagagggcggagagggt
actgtcagacagtataagaggcgattcaaaccgtctgtgttaggagatacgcctcgagcg
gcagttgctgtttttgttctttgtgctgacacggaggagaaggcagaggagcttggggct
gtgcttgattttacacttttggcgggagagcagggtattcctttagagggagttccttcg
tatgaagctgttcggaaaaatacgtattctccttatgaacagagacgaattgctgataat
cgaaatcgaatgattgttggtacgaaagaacaggttaaggagcggctgttagctttgagt
aacgcgtatgaaacagaggaaatcatggtggtgaccatcacgcatcattttgaagataag
ctccgatcgtatcgcttattgcaggaggcgtttgctgactga

DBGET integrated database retrieval system