KEGG   Bacillus subtilis subsp. subtilis 168: BSU38110
Entry
BSU38110          CDS       T00010                                 

Symbol
nfrA
Name
(RefSeq) FMN reductase
  KO
K19285  FMN reductase (NADPH) [EC:1.5.1.38]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU38110 (nfrA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     BSU38110 (nfrA)
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-GeneID: 937279
NCBI-ProteinID: NP_391690
Pasteur: BG10589
BSORF: BG10589
UniProt: P39605 A0A6M3ZHL9
Structure
PDB: 
3N2S

Position
complement(3911477..3912226)
AA seq 249 aa
MNNTIETILNHRSIRSFTDQLLTAEEIDTLVKSAQAASTSSYVQAYSIIGVSDPEKKREL
SVLAGNQPYVEKNGHFFVFCADLYRHQQLAEEKGEHISELLENTEMFMVSLIDAALAAQN
MSIAAESMGLGICYIGGIRNELDKVTEVLQTPDHVLPLFGLAVGHPANLSGKKPRLPKQA
VYHENTYNVNTDDFRHTMNTYDKTISDYYRERTNGKREETWSDQILNFMKQKPRTYLNDY
VKEKGFNKN
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaataacacaatcgaaaccattttgaatcatcggtcaatccggtcttttactgatcag
cttttgacagctgaagaaattgatacattagtgaaaagtgcgcaggctgcgtctacatcc
agctatgtgcaggcatattcgattatcggggtttctgatcctgagaaaaaacgtgagctg
tccgtgcttgctgggaatcagccttacgttgagaagaacggacacttttttgtattttgt
gcggatttgtaccgccatcaacaactggctgaggaaaaaggtgaacatatttctgagctg
ctcgagaatacagaaatgtttatggttagcttgattgatgcggcgctggcagcgcaaaat
atgagcattgccgctgaatccatggggcttggcatttgctatatcggcggcattcggaat
gaattggacaaggtgacagaggtgctgcaaacgcctgaccatgtgctcccgcttttcgga
ctggcagtaggccatcctgcgaacctttccggcaaaaaaccgagattgccaaagcaggcc
gtttatcatgaaaatacgtataatgtgaacacagacgatttccgtcatactatgaatacg
tatgacaaaaccatttctgattactatagagaaagaacaaacgggaagcgggaagaaacg
tggtccgatcaaatactgaactttatgaagcaaaagccgcgtacgtatttaaatgactac
gtgaaagaaaagggctttaataaaaactaa

DBGET integrated database retrieval system