KEGG   Bacillus subtilis subsp. subtilis 168: BSU38120
Entry
BSU38120          CDS       T00010                                 

Gene name
rodA
Definition
(RefSeq) rod shape-determining protein RodA
  KO
K05837  rod shape determining protein RodA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU38120 (rodA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU38120 (rodA)
SSDB
Motif
Pfam: FTSW_RODA_SPOVE
Other DBs
NCBI-GeneID: 937294
NCBI-ProteinID: NP_391691
Pasteur: BG10588
BSORF: BG10588
UniProt: P39604 A0A6M3ZHH9
Position
complement(3912332..3913513)
AA seq 393 aa
MSRYKKQQSPFYQGDLIFIFGVFFIISVVSIYAAGQFGQYGNTDWIQQIVFYLLGAVAIT
VLLYFDLEQLEKLSLYIFIIGILSLIILKISPESIAPVIKGAKSWFRIGRITIQPSEFMK
VGLIMMLASVIGKANPKGVRTLRDDIHLLLKIAGVAVIPVGLILMQDAGTAGICMFIVLV
MVFMSGINWKLIAIIAGSGILLISLILLVMINFPDVAKSVGIQDYQIKRVTSWVSASNET
QEDSNDSWQVDQAIMAIGSGGILGNGISNLKVYVPESTTDFIFSIIGESFGFIGCAIVVI
MFFFLIYRLVVLIDKIHPFNRFASFFCVGYTALIVIHTFQNIGMNIGIMPVTGIPLLFVS
YGGSSTLSTLIGFGIVYNASVQLTKYRSYLFNS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgagtcgatataagaaacagcaaagccccttttaccagggggatttgatttttatattt
ggtgtgttttttattataagcgtagtatcaatatatgctgccggtcagtttgggcagtat
gggaacacggattggattcagcaaattgtgttttatcttttgggggctgtagccattaca
gttcttttgtactttgatttagaacagcttgaaaagttaagtttatatatttttatcatt
ggtattttatctttgattattcttaaaatcagtcccgagtctattgcacctgttattaaa
ggggcaaaaagttggtttaggatcggtagaataacaatacagccgtcagagtttatgaag
gttggtttgattatgatgcttgcttcagttattggaaaagcaaatcctaaaggagttcgg
acgcttagggatgatatccacttgttattaaagattgcgggtgtcgcagttattcctgta
ggtcttatcctgatgcaggatgctgggactgcgggaatatgtatgtttatcgttcttgta
atggtttttatgtcagggataaattggaaattgattgcgatcatagctggttcaggtatc
ttactcatttcattaattttattagtaatgataaactttcctgacgttgctaaatcagtt
ggaatacaggattatcaaattaagcgggtcacttcttgggtgtctgcttcaaatgagaca
caggaagattcaaatgacagctggcaagttgaccaggccatcatggcaataggatctggt
ggtattttaggtaatggtatttctaatttgaaggtttatgttccagagagtacgactgac
tttatcttttctataataggtgagtcatttggctttataggctgtgcaattgttgtcatc
atgttcttctttttaatctacaggcttgttgttctgatagacaaaatacatccgtttaac
cgtttcgcttctttcttttgcgttggctatacggcgttaattgtgatccacacattccag
aatatcggaatgaacattggcattatgcctgttaccgggattccgctgctgtttgtcagc
tatgggggaagctcgacactttccacgttaatcggatttgggattgtatataatgcaagt
gtgcagctgacgaaatacagaagttatctttttaattcttga

DBGET integrated database retrieval system