KEGG   Bacillus subtilis subsp. subtilis 168: BSU38130
Entry
BSU38130          CDS       T00010                                 

Gene name
ywcE
Definition
(RefSeq) spore morphogenesis and germination protein YwcE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YwcE Peptidase_A25
Other DBs
NCBI-GeneID: 937296
NCBI-ProteinID: NP_391692
Pasteur: BG10587
BSORF: BG10587
UniProt: P39603 A0A6M4JQJ6
Position
3914009..3914272
AA seq 87 aa
MMDMFFAYLLVASATPLFIWLDNKKVALSAIPPIILMWVFFFFYATESLSPLGHTLMIIL
FAVNVIVAHIAAFIIYGLPYLRRKRSS
NT seq 264 nt   +upstreamnt  +downstreamnt
atgatggacatgttttttgcttacttattggttgccagcgcaacgcctctctttatttgg
cttgataacaaaaaagtcgcactctcagctattccgccaatcattttaatgtgggtattc
ttcttcttttacgcaacagaaagcctttctccacttggacacactctcatgattatcttg
tttgccgttaacgtcattgtcgctcatatcgccgcatttatcatttacggccttccgtat
cttcgcagaaagcgaagcagctga

DBGET integrated database retrieval system