KEGG   Bacillus subtilis subsp. subtilis 168: BSU38140
Entry
BSU38140          CDS       T00010                                 

Symbol
qoxD
Name
(RefSeq) quinol oxidase subunit 4
  KO
K02829  cytochrome aa3-600 menaquinol oxidase subunit IV [EC:7.1.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00416  Cytochrome aa3-600 menaquinol oxidase
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU38140 (qoxD)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.5  menaquinol oxidase (H+-transporting)
     BSU38140 (qoxD)
SSDB
Motif
Pfam: COX4_pro MerC Bax1-I DUF5336 Polysacc_synt EcsB
Other DBs
NCBI-GeneID: 937285
NCBI-ProteinID: NP_391693
Pasteur: BG10586
BSORF: BG10586
UniProt: P34959 A0A6M3ZHX9
Position
complement(3914315..3914689)
AA seq 124 aa
MANKSAEHSHFPWKHIVGFILSIVLTLLALWVAVYTDLSSSAKLWIIFGFAFIQAALQLL
MFMHMTESENGTIQVGNTLFGFFGAIVIVLGSIWIFAAHYHHGDHMDGNPPGGAEHSEHS
GHNE
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcaaacaaatctgctgaacacagtcactttccatggaaacacattgtaggttttatc
ctgtctatcgttttgaccctgctggctctatgggttgcagtgtatactgacctgagctca
tcagcaaaactttggattatcttcggcttcgccttcattcaggcggcgctgcagcttctc
atgttcatgcatatgacagagagcgaaaacggcacgatccaagtcggaaacacgctgttc
ggattctttggcgcgatcgttatcgtacttggatccatctggattttcgcggctcactat
caccatggtgaccatatggacggaaatcctcctggaggcgctgaacactcagagcattca
ggccataacgaataa

DBGET integrated database retrieval system