KEGG   Bacillus subtilis subsp. subtilis 168: BSU38150
Entry
BSU38150          CDS       T00010                                 

Gene name
qoxC
Definition
(RefSeq) quinol oxidase subunit 3
  KO
K02828  cytochrome aa3-600 menaquinol oxidase subunit III [EC:7.1.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00416  Cytochrome aa3-600 menaquinol oxidase
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU38150 (qoxC)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.5  menaquinol oxidase (H+-transporting)
     BSU38150 (qoxC)
SSDB
Motif
Pfam: COX3 DUF6186
Other DBs
NCBI-GeneID: 937299
NCBI-ProteinID: NP_391694
Pasteur: BG10585
BSORF: BG10585
UniProt: P34958 A0A6M3ZLJ2
Position
complement(3914691..3915305)
AA seq 204 aa
MEHAEHGNSNAPMEYQSETGRLNILGFWIFLGAEIVLFSTLFATFFVLKNRTAGGVLPDE
LFEVNLVMIMTFLLLISSFTCGIAVHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVH
YVHEGAALSTSAFWSGFFVLLGTHGTHVTIGIFWITGILIQLKKRGLTPQTSSKIFISSL
YWHFLDVVWIFIFTGVYLMGLGGL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggaacatgcagaacacggcaattctaacgcgcctatggaatatcaatctgaaaccggc
agacttaatattctcgggttttggatctttttaggggcagaaattgtgttgttctcaaca
ctatttgcaaccttcttcgttcttaaaaacagaacagctggaggtgtcttgccagacgaa
ctatttgaagtcaatctggtaatgattatgacgttcttgctgctgatcagcagctttacc
tgcgggatcgctgttcatgaaatgcgccgcggaagtttaaaaggcgtagtcatttggaca
attatcactcttcttctcggtgccggcttcgtcggatgcgagatcaacgagtttgttcac
tatgtacatgaaggagcggctctcagtacaagtgcgttctggtctggattctttgtttta
cttggaactcacggaactcacgtaacaatcgggattttctggatcacaggaattctgatt
cagttgaagaaacgcggcttaactccgcaaacttcatctaaaatctttatctcaagcttg
tactggcacttcttagatgttgtatggattttcatctttacaggtgtctatctcatggga
ttggggggtctgtaa

DBGET integrated database retrieval system