KEGG   Bacillus subtilis subsp. subtilis 168: BSU38160
Entry
BSU38160          CDS       T00010                                 

Symbol
qoxB
Name
(RefSeq) quinol oxidase subunit 1
  KO
K02827  cytochrome aa3-600 menaquinol oxidase subunit I [EC:7.1.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00416  Cytochrome aa3-600 menaquinol oxidase
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU38160 (qoxB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.5  menaquinol oxidase (H+-transporting)
     BSU38160 (qoxB)
SSDB
Motif
Pfam: COX1 RELT
Other DBs
NCBI-GeneID: 937303
NCBI-ProteinID: NP_391695
Pasteur: BG10584
BSORF: BG10584
UniProt: P34956 A0A6M4JQH0
Position
complement(3915319..3917268)
AA seq 649 aa
MKFKWDEFFVTGDPLILGAQVSIALSTIAIIFVLTYFKKWKWLWSEWITTVDHKKLGIMY
IISAVIMLFRGGVDGLMMRAQLALPNNSFLDSNHYNEIFTTHGTIMIIFMAMPFLIGLIN
VVVPLQIGARDVAFPYLNNLSFWTFFVGAMLFNISFVIGGSPNAGWTSYMPLASNDMSPG
PGENYYLLGLQIAGIGTLMTGINFMVTILKMRTKGMTLMRMPMFTWTTLITMVIIVFAFP
VLTVALALLSFDRLFGAHFFTLEAGGMPMLWANLFWIWGHPEVYIVILPAFGIFSEIISS
FARKQLFGYKAMVGSIIAISVLSFLVWTHHFFTMGNSASVNSFFSITTMAISIPTGVKIF
NWLFTMYKGRISFTTPMLWALAFIPNFVIGGVTGVMLAMAAADYQYHNTYFLVSHFHYVL
IAGTVFACFAGFIFWYPKMFGHKLNERIGKWFFWIFMIGFNICFFPQYFLGLQGMPRRIY
TYGPNDGWTTLNFISTVGAFMMGVGFLILCYNIYYSFRYSTREISGDSWGVGRTLDWATS
SAIPPHYNFAVLPEVKSQDAFLHMKEEKTELYPESKFKKIHMPSNSGRPFFMSVAFGLAG
FGLVFEWYWMGVVGLIGVLLCMVLRSFEYDNGYYISVDEIKETERKISE
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgaaattcaaatgggacgaatttttcgtaactggtgacccattaattctgggcgcacaa
gtttccattgcgctttcaaccattgccattatttttgttctgacttacttcaaaaagtgg
aaatggctgtggtctgaatggataactactgttgaccataaaaaactcggaatcatgtat
attatatctgctgtaattatgttattccgtggcggtgtcgacggtctgatgatgcgtgcc
cagctagcgcttccgaataacagttttttagactcaaaccactataatgaaatttttaca
actcacggtacaatcatgatcatcttcatggcgatgccgttcttaatcggtcttatcaac
gttgttgtgcctcttcaaatcggtgcccgcgacgttgcgttcccttacttgaacaacctg
agcttctggacgttctttgtaggggcgatgcttttcaatatttctttcgttatcggaggt
tctccgaacgcaggctggacgagttatatgccgcttgcaagtaacgacatgagccctggg
ccgggtgagaactactacctcctcggacttcagattgccggtatcggtaccctgatgaca
gggatcaactttatggtaacaatcttaaaaatgagaacaaaaggcatgacattaatgcgt
atgccgatgttcacatggacaacactgatcacaatggttattatcgtgtttgcgttccct
gtacttacagtagcattagcacttttatcatttgatcgtttgttcggcgctcactttttc
acattggaagcaggcggtatgccgatgctttgggctaacttgttctggatttggggacat
cctgaagtatatatcgttattcttccggcgtttggtattttctcagaaatcatctcaagc
tttgcaagaaaacaattgtttggttacaaagcgatggttggttctattatcgccatctct
gtattgagtttcttagtttggactcaccacttcttcacaatggggaacagtgcgtccgtt
aactcattcttctcaattacgacaatggcaatctcaatcccaaccggggttaaaatcttt
aactggctctttacaatgtataaaggccgaatcagctttacaacacctatgctgtgggcg
cttgcgttcattcctaacttcgttatcggcggggttacaggggttatgcttgcgatggca
gcagcggattatcaataccataatacgtacttccttgtatctcacttccactatgtgctg
attgcgggtactgtatttgcttgtttcgccggatttattttctggtatccaaaaatgttc
ggccacaagctgaacgaaagaatcggaaaatggttcttctggatctttatgatcgggttc
aatatttgtttcttcccgcaatatttcttggggcttcaaggcatgccgcgccgtatttac
acatacggaccgaatgacggctggacaacattgaactttatctcaacagtcggagctttc
atgatgggtgtaggattcttaatcctttgctataacatctactacagcttccgttactct
actcgtgaaatcagcggagattcatggggtgtgggacgtacgcttgattgggcgacttct
tctgcgattccgccgcattacaactttgcggtgcttcctgaagtcaaatctcaagatgca
ttcctgcatatgaaagaagaaaaaactgaattataccctgaaagcaaattcaagaaaatc
catatgccaagcaactcaggcagaccgttctttatgtctgttgccttcggtctcgcaggc
tttggacttgtctttgaatggtactggatgggcgtagtcggattgatcggagtcctgctc
tgcatggttctgcgttcattcgaatacgacaacggctactacattagtgttgatgaaata
aaagagacggaaagaaagatttccgaataa

DBGET integrated database retrieval system