KEGG   Bacillus subtilis subsp. subtilis 168: BSU38170
Entry
BSU38170          CDS       T00010                                 

Gene name
qoxA
Definition
(RefSeq) quinol oxidase subunit 2
  KO
K02826  cytochrome aa3-600 menaquinol oxidase subunit II [EC:7.1.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00416  Cytochrome aa3-600 menaquinol oxidase
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU38170 (qoxA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.5  menaquinol oxidase (H+-transporting)
     BSU38170 (qoxA)
SSDB
Motif
Pfam: COX2_TM COX2 Syndecan Yip1 COX_ARM DUF6057 PIRT DUF2070
Other DBs
NCBI-GeneID: 937295
NCBI-ProteinID: NP_391696
Pasteur: BG10583
BSORF: BG10583
UniProt: P34957 A0A6M3ZIW8
Position
complement(3917296..3918261)
AA seq 321 aa
MIFLFRALKPLLVLALLTVVFVLGGCSNASVLDPKGPVAEQQSDLILLSIGFMLFIVGVV
FVLFTIILVKYRDRKGKDNGSYNPEIHGNTFLEVVWTVIPILIVIALSVPTVQTIYSLEK
APEATKDKEPLVVYATSVDWKWVFSYPEQDIETVNYLNIPVDRPILFKISSADSMASLWI
PQLGGQKYAMAGMLMDQYLQADKVGTYEGRNANFTGEHFADQEFDVNAVTEKDFNSWVKK
TQNEAPKLTKEKYDELMLPENVDELTFSSTHLKYVDHGQDAEYAMEARKRLGYQAVSPHS
KTDPFENVKKNEFKKSDDTEE
NT seq 966 nt   +upstreamnt  +downstreamnt
gtgatcttcttgttcagagcattaaaaccgttgcttgtattagcgctgttaactgtggtt
ttcgtccttgggggatgcagcaatgcttcagtactagatccgaaaggacctgtagctgaa
cagcaaagtgatttaatcctgttatctatcggatttatgctgtttatcgtcggggtcgtc
tttgttctatttaccattattttagtaaaataccgcgaccgtaaaggcaaagataatgga
tcttataacccagaaattcacggtaacacgtttttagaagtagtctggacagtgatccca
attttaatcgtcattgcactttctgtgccaacagtacagacgatatattcgttagaaaaa
gctcctgaagcaacaaaagacaaagagcctcttgttgtttatgctacttcggtagactgg
aaatgggtatttagctaccctgaacaggatattgaaacggtcaactacttaaacattcct
gtcgaccgcccgatcttgttcaaaatctcatctgcagattcaatggcttcgctatggatt
cctcagcttggagggcaaaaatatgcgatggcaggaatgctgatggatcaatacttacag
gctgacaaagtgggtacttacgaaggccgcaacgcgaacttcacaggtgaacattttgca
gaccaagagtttgatgtgaatgcagtcacagaaaaagactttaacagctgggtgaaaaag
actcagaacgaggctcctaagctgacaaaagagaagtatgatgaattgatgcttcctgaa
aatgtggacgaattaacgttctcttctactcacttgaaatacgttgatcacggacaagac
gctgagtacgcgatggaggcgcgcaaacgccttggctatcaagccgtttcaccgcattct
aaaacagatccgtttgaaaacgtaaagaaaaacgaatttaagaagtctgatgatacagaa
gaatga

DBGET integrated database retrieval system