KEGG   Bacillus subtilis subsp. subtilis 168: BSU38180
Entry
BSU38180          CDS       T00010                                 

Symbol
ywzA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Transgly_assoc
Other DBs
NCBI-GeneID: 937305
NCBI-ProteinID: NP_391697
Pasteur: BG14162
BSORF: BG14162
UniProt: O32282 A0A6M3ZJ15
Position
3918777..3919022
AA seq 81 aa
MSFLISLIVAIIIGWLGSLFVKGDMPGGIIGSMIAGLIGAWIGHGLLGTWGPHLAGFAII
PAVIGAAIVVFLVSLLTRKRG
NT seq 246 nt   +upstreamnt  +downstreamnt
atgagttttcttatttcacttatcgtcgctattattatcggatggcttggaagcctgttt
gtaaaaggagatatgcccggaggaattatcgggtctatgatcgcaggtcttataggcgcc
tggatcggacacgggctgcttggaacatgggggccgcacctagccggatttgccattatt
ccagcggtaatcggcgcagccattgttgtctttctagtaagcctgttaaccagaaaaaga
ggataa

DBGET integrated database retrieval system