KEGG   Bacillus subtilis subsp. subtilis 168: BSU38210
Entry
BSU38210          CDS       T00010                                 

Symbol
ywcD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GtrA
Other DBs
NCBI-GeneID: 937313
NCBI-ProteinID: NP_391700
Pasteur: BG10580
BSORF: BG10580
UniProt: P39602 A0A6M3ZIW1
Position
complement(3921891..3922274)
AA seq 127 aa
MYIIMGVFTTIVNIASFYILVEIMNVDYKAATVAAWILSVLFAYITNKLYVFQQKTHDLQ
SLLKELTAFFSVRVLSLGIDLGMMIILVGQFNTNETLAKILDNAVIVVVNYVASKWLVFK
KTKEEGV
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtatatcattatgggggttttcacaaccattgtgaatatcgccagcttttatatattg
gtagagatcatgaatgtggattacaaagccgccactgttgccgcttggattttgtccgtg
ctgtttgcttacataacaaataaattatatgtgtttcagcaaaaaacacatgatctgcag
agcctgctgaaagagctcactgcttttttcagcgttcgggtcctgtctctcggcatagat
ttaggcatgatgatcattcttgtcggccagttcaatacaaatgaaaccttggccaaaata
ctcgacaacgcggtcattgttgtcgtcaactatgttgcgagcaaatggctcgtctttaaa
aaaacaaaagaagaaggggtatga

DBGET integrated database retrieval system