KEGG   Bacillus subtilis subsp. subtilis 168: BSU38220
Entry
BSU38220          CDS       T00010                                 

Gene name
ywcC
Definition
(RefSeq) HTH-type transcriptional regulator YwcC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_N TetR_C_6
Other DBs
NCBI-GeneID: 937314
NCBI-ProteinID: NP_391701
Pasteur: BG10579
BSORF: BG10579
UniProt: P39601 A0A6M3ZHS4
Position
complement(3922292..3922963)
AA seq 223 aa
MKKNKFQIKREATFESFIDAGVNLLIDRAYDPVSVEDISRAAGYSKGAFYVHFVSKDDFL
LYLLEKRQMKKKIIIGYLDQMERESVKSLTLDEAAKHAAELLYSYYINKPSWDITSFAMN
MPTYKVLKKCKAYVRLYELWVEENVLYIKWLKERKLIDACIDPEYTAKIICAVLDGIIKQ
SYVLGQPATFRSFLDALSVFFTLDREHERPRILKSFSESEEHQ
NT seq 672 nt   +upstreamnt  +downstreamnt
atgaaaaaaaacaaatttcaaattaaaagagaagcaacatttgaaagttttatagacgct
ggcgtgaatttgttgattgaccgagcgtatgatccggtttctgtagaagatatcagcaga
gccgccgggtacagcaaaggagcattttatgttcattttgtcagcaaggacgattttctg
ctgtaccttctcgaaaaacgtcagatgaaaaaaaagatcattatagggtatcttgatcaa
atggagcgggagtcagtgaaatcgctgacattggacgaggctgcaaaacacgctgcagaa
ctgctttattcctattacataaataagccgtcgtgggacatcacctcgtttgccatgaac
atgccgacatataaagtcttaaagaaatgcaaggcctatgtccggctgtacgaattgtgg
gtggaagaaaatgtgttatatattaagtggctgaaggagagaaagctgattgacgcctgt
attgatcctgaatatacggctaaaataatatgtgcagtcctcgacggaatcatcaaacaa
tcatatgtattgggccagccagccaccttccgcagctttttagacgcactctcggtattt
tttactttagacagagagcacgagaggccaagaattttgaaaagtttttcagaaagcgag
gaacatcagtga

DBGET integrated database retrieval system