KEGG   Bacillus subtilis subsp. subtilis 168: BSU38229
Entry
BSU38229          CDS       T00010                                 

Symbol
slrA
Name
(RefSeq) transcriptional regulator SlrA
  KO
K19432  anti-repressor of SlrR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    BSU38229 (slrA)
SSDB
Motif
Pfam: SinI
Other DBs
NCBI-GeneID: 8303165
NCBI-ProteinID: YP_003097794
UniProt: P0C8M5
Position
3923319..3923477
AA seq 52 aa
MKTHVKKDLDKGWHMLIQEARSIGLGIHDVRQFLESETASRKKNHKKTVRQD
NT seq 159 nt   +upstreamnt  +downstreamnt
atgaaaactcatgttaaaaaagatttggacaaaggttggcatatgttaattcaagaagct
agatccattggattaggcattcatgatgtgaggcagtttttagaatctgagacagcatca
agaaagaaaaaccacaaaaaaaccgtccggcaagactag

DBGET integrated database retrieval system