KEGG   Bacillus subtilis subsp. subtilis 168: BSU38230
Entry
BSU38230          CDS       T00010                                 

Symbol
ywcB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF485 Popeye DUF2721
Other DBs
NCBI-GeneID: 937304
NCBI-ProteinID: NP_391702
Pasteur: BG10578
BSORF: BG10578
UniProt: P39600 A0A6M4JQL1
Position
3923920..3924228
AA seq 102 aa
MYKADYKQIAATPSFQAFLKQKRAFIVPSAIFFFVFYFSLPVLTSYFTFLNAPAIGAVSW
AWLFAIAQFAMTWILSTVYSRRAAHFDKYVSALKEDLKGEQT
NT seq 309 nt   +upstreamnt  +downstreamnt
atgtacaaagctgattataaacagattgctgcaacgccgtcttttcaagcttttttaaag
cagaaacgcgcttttattgttccttctgcgattttcttttttgttttttatttttcactc
cctgttttgacatcttatttcacctttttgaatgcaccggccattggagctgtttcatgg
gcttggctgttcgccatcgcccaattcgctatgacctggatactgagtactgtgtattcc
cggagagccgcccatttcgataagtatgtaagcgctttaaaagaggatctgaagggtgaa
cagacatga

DBGET integrated database retrieval system