KEGG   Bacillus subtilis subsp. subtilis 168: BSU38240
Entry
BSU38240          CDS       T00010                                 

Symbol
ywcA
Name
(RefSeq) symporter
  KO
K14393  cation/acetate symporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38240 (ywcA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU38240 (ywcA)
SSDB
Motif
Pfam: SSF AA_permease_2 COX4_pro_2 DUF6442
Other DBs
NCBI-GeneID: 937320
NCBI-ProteinID: NP_391703
Pasteur: BG10577
BSORF: BG10577
UniProt: P39599 A0A6M3ZHN0
Position
3924225..3925766
AA seq 513 aa
MNMTAFLLFLAIVGLTLIITYFAAKRTKTTSEFYTAGGGLTGVQNGLAIAGDYMSAASFL
GIAGMIALYGFDGFFYSIGFLVAYLVVLYIVAEPLRNLGKYTMADMIAARFKEKKIRGVA
ALNTIAISTFYMIAQLVGAGALIKLLLGLDYTAAVLIVGVLMTIYVVFGGMIATSWVQII
KAVLLMAGTLVISIIVFSKFGFSLNTMFEQMKTATPLGADFLNPGNKYKVPLETLSLNLA
LVLGTAGLPHILIRFYTVKDAKTARTSVVSATWIIGVFYIMTVFLGFGAAAFVGFDAITA
ADQAGNMAAPLLAKALGGDFLFAFVSAIAFATILAVVTGLVLSAASAFAHDIYSQIIRKG
EATEKEQMKAARWASVAVSVLSILLAIFAQSLNVAFLVALAFAVAASANLPLIVFTVFWK
RFNASGALWGSLTGLISALVLVSMSPSVWDPAGGAIFTGDPLIPLSNPGIISIPLGFLGA
WLGTVLSSDKTIDEDTFAEIQVKAHTGVHMEQE
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaatatgactgcttttttattatttttggcgattgttggcctgacgcttattatcacg
tattttgccgcgaagcggacgaaaacgacgagtgagttttatacggcgggcggcgggctc
accggcgttcagaatggactggcaattgccggtgactacatgtctgccgcctcgtttctc
gggattgccggaatgattgcgttatatggatttgatggcttcttttacagcatcggtttt
ctggtggcttatctcgttgtcttgtacatcgtggcggagccgcttcggaatcttggaaag
tacacgatggcagacatgattgccgctcgctttaaagaaaagaaaatccgcggtgtcgcg
gctctcaataccattgccatctctactttttatatgatcgcccagctcgtgggggcgggc
gcgctgatcaaactgcttctagggctggattataccgcggctgtcctcatcgtcggagtg
ctgatgaccatttatgtcgtgtttggcggcatgatcgcgacaagctgggttcaaattatt
aaagctgttttgctgatggccggcacactcgtgatttcgattatcgtgttttcgaaattc
ggctttagccttaataccatgtttgaacagatgaaaacggctactccgcttggcgctgat
tttttgaaccccggaaataaatacaaggtgccgcttgagaccttgtcgttaaacttggca
ctcgtgctgggaaccgccgggcttccgcatatattgatccggttttataccgttaaggat
gccaagacggcccgtacatccgttgtgtcagcgacatggattatcggtgtgttttacatt
atgacggtatttctcggctttggtgccgcggcatttgtcggttttgacgcgattacggcg
gctgatcaagcgggaaatatggcggctccgcttttagcaaaagcgctcggaggagacttt
ctgttcgcgtttgtatcagccatcgcctttgccaccattttggctgtcgtgacagggttg
gtgctgtctgccgcctcagcatttgcccatgatatttacagccagatcatcagaaaggga
gaagcaactgaaaaagaacaaatgaaagcggccagatgggcttctgtcgccgtgtcagtg
ctctcgattctccttgcgatttttgcacaatccttaaatgtggcgttccttgttgcactc
gcgtttgcggtagccgccagcgcaaaccttccgctgattgtgtttacagtcttctggaaa
cgattcaatgcctcaggcgctttatggggcagcctgacaggcctgatcagcgcgcttgtg
ctggtatcgatgagccctagtgtgtgggacccggccggaggtgctatttttaccggtgat
ccgctcattccgctatctaatccaggaattatttccatcccgctcggctttctcggcgcg
tggctcggaacggtgctgtcgtctgataaaacaattgatgaagatacgtttgcagaaatt
caggtgaaggcgcatactggcgtccatatggaacaggaataa

DBGET integrated database retrieval system