KEGG   Bacillus subtilis subsp. subtilis 168: BSU38250
Entry
BSU38250          CDS       T00010                                 

Symbol
ywbO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_5 ScdA_N
Other DBs
NCBI-GeneID: 937309
NCBI-ProteinID: NP_391704
Pasteur: BG10576
BSORF: BG10576
UniProt: P39598 A0A6M4JQG5
Position
complement(3925797..3926399)
AA seq 200 aa
MTVHIKVYSDYVCPFCFVGKAAFEEAIKGKDVEVEWMPFELRPSPSPQLDPVNDPSKQYM
WQTSIQPMAEKLGVEINFPNVSPHPYTDLAFEGFHFAKEYNKGHEYNTRVFQAFFQEDQN
IGDIDILTKLAEEVGLDGASFKSALETRTYQDVQRQALKHAYEEADITAVPTFIIGDTVI
PGAAGKDVFEKAISDEQKKK
NT seq 603 nt   +upstreamnt  +downstreamnt
atgacagtacacattaaagtttattcagattacgtctgcccattttgttttgttggaaaa
gccgcttttgaagaagcgataaaaggaaaggatgttgaagtcgagtggatgccgtttgaa
ctgcgcccaagcccatctcctcagcttgatccggtcaatgatccttctaaacagtacatg
tggcagacatcaattcagccaatggcggagaaattaggagtcgagatcaattttccaaac
gtctcgccccatccgtatacagacctcgcgtttgaaggcttccattttgcgaaggaatac
aataaaggacatgaatacaacacccgtgtctttcaggcatttttccaggaggaccaaaat
atcggcgatattgacatcttgacgaagctcgccgaggaagtgggattagacggtgcatca
ttcaaatcagcactggaaacaagaacatatcaggacgtgcagcgccaagccttgaagcac
gcctatgaagaggctgacatcacagccgttccaacctttattatcggtgacactgtaatt
ccgggtgctgccggcaaggatgtatttgaaaaagcgatttctgacgagcagaagaaaaag
taa

DBGET integrated database retrieval system