KEGG   Bacillus subtilis subsp. subtilis 168: BSU38260
Entry
BSU38260          CDS       T00010                                 

Symbol
efeN
Name
(RefSeq) deferrochelatase/peroxidase EfeN
  KO
K16301  deferrochelatase/peroxidase EfeB [EC:1.11.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38260 (efeN)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     BSU38260 (efeN)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU38260 (efeN)
SSDB
Motif
Pfam: Dyp_perox TAT_signal mIF3
Other DBs
NCBI-GeneID: 937310
NCBI-ProteinID: NP_391705
Pasteur: BG10575
BSORF: BG10575
UniProt: P39597 A0A6M3ZK84
Position
complement(3926682..3927932)
AA seq 416 aa
MSDEQKKPEQIHRRDILKWGAMAGAAVAIGASGLGGLAPLVQTAAKPSKKDEKEEEQIVP
FYGKHQAGITTAHQTYVYFAALDVTAKDKSDIITLFRNWTSLTQMLTSGKKMSAEQRNQY
LPPQDTGESADLSPSNLTVTFGFGPGFFEKDGKDRFGLKSKKPKHLAALPAMPNDNLDEK
QGGGDICIQVCADDEQVAFHALRNLLNQAVGTCEVRFVNKGFLSGGKNGETPRNLFGFKD
GTGNQSTKDDTLMNSIVWIQSGEPDWMTGGTYMAFRKIKMFLEVWDRSSLKDQEDTFGRR
KSSGAPFGQKKETDPVKLNQIPSNSHVSLAKSTGKQILRRAFSYTEGLDPKTGYMDAGLL
FISFQKNPDNQFIPMLKALSAKDALNEYTQTIGSALYACPGGCKKGEYIAQRLLES
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgagcgatgaacagaaaaagccagaacaaattcacagacgggacattttaaaatgggga
gcgatggcgggggcagccgttgcgatcggtgccagcggtctcggcggtctcgctccgctt
gttcagactgcggctaagccatcgaaaaaggatgaaaaagaggaggagcagattgttccg
ttttacggaaagcatcaggccggaatcacaactgcccatcagacgtatgtctattttgct
gcactggatgtaacagcaaaagacaaaagcgacatcattacgttatttagaaactggaca
agtctcacacagatgctgacgtctggcaagaaaatgtcagcggagcagagaaatcagtat
ctgccgccgcaggatacaggtgagtctgctgatttatccccttccaacttaacggtcaca
ttcggattcgggcctggcttttttgaaaaagacggaaaggaccgcttcggactgaaaagc
aaaaaaccgaagcacctagccgctcttccagcgatgcccaatgacaacctggatgaaaag
cagggaggcggggacatctgcattcaagtgtgtgcagacgacgagcaagtggcgtttcac
gcgctgcgtaacctgctaaatcaagcggtcggcacttgtgaggtccgttttgtgaacaaa
ggctttttaagcggtggaaaaaatggtgaaacaccgcgcaacctcttcgggtttaaagat
ggaacaggcaaccagagcacgaaggatgacacgttgatgaactcgatcgtgtggattcag
tctggtgagcctgactggatgacgggcggcacctatatggcttttcggaaaatcaaaatg
ttccttgaggtatgggaccgctcttccctcaaggaccaagaggataccttcggccgcaga
aaaagctcgggggcgccttttgggcagaaaaaggaaacagatcccgtgaagctgaatcaa
attccgtctaattcacacgtcagtctagcgaaatctactgggaaacaaattttgcgaaga
gctttctcttacacagaaggacttgatccgaaaaccggctatatggatgcaggtctcctg
tttatcagttttcaaaaaaatcccgacaatcagtttatcccgatgctgaaggctctttca
gcaaaggatgcgttaaacgaatatacacaaacaatcggttctgctttatacgcatgccca
ggcggctgcaaaaaaggagaatatattgcccagcgtttgctggaatcataa

DBGET integrated database retrieval system