KEGG   Bacillus subtilis subsp. subtilis 168: BSU38270
Entry
BSU38270          CDS       T00010                                 

Symbol
efeM
Name
(RefSeq) iron uptake system component EfeM
  KO
K07224  iron uptake system component EfeO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38270 (efeM)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU38270 (efeM)
SSDB
Motif
Pfam: Peptidase_M75 DUF4363 Imm3 Anti-adapt_IraP PCYCGC Apolipoprotein OmpH
Other DBs
NCBI-GeneID: 937322
NCBI-ProteinID: NP_391706
Pasteur: BG10574
BSORF: BG10574
UniProt: P39596 A0A6M4JQI9
Position
complement(3927951..3929108)
AA seq 385 aa
MNFTKIAVSAGCILALCAGCGANDTSSTKEKASSEKSGVTKEITASVNKMETIISKLNDS
VEKGDQKEIEKKGKELNSYWLSFENDIRSDYPFEYTEIEKHLQPIYTEAQKDKPDAGKIK
TESESLKASLEDLTEAKKSGKKASDQLAKAADEYKGYVKEQSDQLVKATEAFTGAVKSGD
IEKSKTLYAKARVYYERIEPIAESLGDLDPKIDARENDVEEGDKWTGFHKLEKAIWKDQD
ISGEKATADQLLKDVKELDGSIQSLKLTPEQIVAGAMELLNEAGISKITGEEERYSRIDL
VDLMANVEGSEAVYQTVKSALVKDHSDLTEKLDTEFSEFEVLMAKYKTNDQSYTSYDKLS
EKQIRELSTKLTTLSETMSKIANVL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaatttcacaaaaatcgctgtatcagccggatgcatccttgcgctgtgcgcaggctgc
ggagccaatgacacatcttcaaccaaagaaaaagcttcatctgaaaaaagcggggtcact
aaagaaatcaccgcatccgtaaataaaatggaaaccatcatttctaagctgaatgactca
gtggaaaaaggagaccaaaaagagattgaaaagaaggggaaagagttaaacagctactgg
ctttcctttgaaaacgatattcgcagcgactatccattcgaatatacagaaatcgaaaag
catcttcagccaatctacacagaagcgcaaaaagacaaaccggatgcaggaaaaatcaag
acagaatccgagtcattgaaagcatccttagaagacctgacagaagcgaagaagagcggc
aaaaaggctagcgatcagctggcaaaagcagcggatgagtataaaggctatgtcaaagag
cagagtgaccagcttgtcaaagcgactgaagcatttacgggtgctgtgaaatccggcgat
atcgaaaagtccaaaacgttatatgcgaaagcgcgtgtttattacgagcgaatcgaaccg
atcgctgaaagcctcggagatcttgatccgaaaattgacgcacgagaaaacgatgttgaa
gaaggagacaaatggacaggcttccataagcttgagaaggccatttggaaggatcaagat
atttccggggaaaaggcaacagctgaccagcttctcaaggatgtaaaagagcttgacggt
tcaattcaatcactgaaattaacacctgaacaaattgttgcaggcgcgatggagcttctg
aacgaagccggaatttcgaaaatcacgggagaagaagagcgctactcacgaattgattta
gttgaccttatggcaaatgtggaaggctccgaagccgtttatcaaacagtgaaaagcgcg
cttgtaaaagatcactccgacttgacggaaaaactggatacggagttcagcgaatttgaa
gttttaatggcaaaatacaaaacaaatgatcagtcctatacgtcttatgataaattaagt
gaaaagcaaatcagagagctgagcactaagctgacgactctttctgaaaccatgtcgaag
attgcgaatgtgctataa

DBGET integrated database retrieval system