KEGG   Bacillus subtilis subsp. subtilis 168: BSU38280
Entry
BSU38280          CDS       T00010                                 

Gene name
efeU
Definition
(RefSeq) ferrous iron permease EfeU
  KO
K07243  high-affinity iron transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38280 (efeU)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU38280 (efeU)
SSDB
Motif
Pfam: FTR1 DUF4363 Cytochrom_B562
Other DBs
NCBI-GeneID: 938520
NCBI-ProteinID: NP_391707
Pasteur: BG10573
BSORF: BG10573
UniProt: P39595 A0A6M3ZIW5
Position
complement(3929105..3930550)
AA seq 481 aa
MARGLALILFSLLMVFGSAAHAEDDPIAALIQLNKQMIKSVKDGDMDSAQQTFDTFKAKW
KKEEPSIKKENLSSHSEMDANIAMISLSFINQDARKLKTQLEELASHLETYQQAVVLKKT
SSGQSRASLTAYIQSLKDTKQFIEKKQLDEASSAIDNLVTSWLAVEGDVVSQSKEAYTTS
EENLALMKAEIGSHPEKVSKQIDEMIQLLEPIASSSYSWWDAALIPVREGMEALLVIGAL
LTMTKKARVTRSSTWIWGGASAGMAVSLAAGIGVTVLFSSSVFGENNFLLGGVTGVLSAV
MLLYVGVWLHRNASMDKWREKINIQKSQALKKRSLLSFALIAFLAVVREGLETVIFFIGL
VGKLPLTELIGGTAAGLIVLVIVGVLMIKLGMRIPLKPFFLLSMAVVLYMCVKFLGTGVH
SLQLAGILPSDAESWLPSVSVLGIYPSVYSTIPQMLILLFLLIALVSEAAKHFTNGKELT
K
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctcgggggctggcacttattctattcagcttgttgatggttttcggttctgcggca
catgcggaagatgatccgatcgccgcattaattcaattaaacaagcaaatgatcaaatcc
gtaaaagacggggatatggattcggcacaacaaacgtttgacaccttcaaggcgaagtgg
aaaaaagaagaaccttctattaagaaagaaaacctttcttctcacagtgaaatggacgcg
aatatcgcgatgatttctctttcttttatcaatcaagacgcacgtaagctcaaaacacag
cttgaagagcttgcgtctcatttagaaacctatcagcaggctgtcgtgctgaaaaagaca
tcctcaggtcaatcaagggcgtccttaacagcctatatacaaagcttgaaagacacaaaa
cagttcatagaaaaaaaacaattggatgaagcgtcatccgcaatcgacaatttagttaca
tcctggctcgctgttgagggagatgtcgtgtcccaatcgaaagaagcctatacgacatcg
gaggaaaatctggcgctgatgaaggcggagatcggcagccatcctgaaaaggtatcaaag
caaattgacgaaatgattcaattgctcgagccgatcgcttcaagcagctacagctggtgg
gatgcggcgctgatcccggttcgtgaaggaatggaggccctccttgtcatcggagcgcta
ttaaccatgacaaaaaaagcgcgggttacgcgttcctcgacatggatctggggcggggcg
tccgccggcatggctgtttccttagcagccggcatcggtgtcacggttctgttctcctcc
agtgtattcggagaaaacaatttcttgcttggcggcgttaccggcgtactgtccgctgtc
atgcttttgtatgtcggggtgtggctgcacagaaacgcctcaatggataaatggagagaa
aaaatcaatatccagaagtcacaggcactaaaaaaacgaagcctgctttcctttgcgctc
attgcatttctggcagttgtaagagaaggtctcgaaacggtcatctttttcatcgggctt
gtcgggaagctcccgctcactgaactgatcggcggaactgccgcagggcttatcgttctc
gtcatcgtcggtgttctgatgatcaagctcggaatgcgcattccattgaagccgtttttt
cttctatcaatggcggttgtcctgtatatgtgcgtgaaatttctcggaaccggcgttcac
agccttcaactggcgggcattcttccgtctgatgcagaaagctggctgccgtctgtatcg
gtgctaggaatttatccgtctgtgtacagcacgattccgcaaatgttgattttactcttt
ttactgattgcgcttgtttcagaagcggcaaaacattttacaaacggaaaggaactgaca
aaatga

DBGET integrated database retrieval system