KEGG   Bacillus subtilis subsp. subtilis 168: BSU38290
Entry
BSU38290          CDS       T00010                                 

Gene name
thiE
Definition
(RefSeq) thiamine-phosphate synthase
  KO
K00788  thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00895  Thiamine biosynthesis, prokaryotes, AIR (+ DXP/glycine) => TMP/TPP
bsu_M00899  Thiamine salvage pathway, HMP/HET => TMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU38290 (thiE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     BSU38290 (thiE)
SSDB
Motif
Pfam: TMP-TENI ThiG QRPTase_C DUF561 DHO_dh
Other DBs
NCBI-GeneID: 937316
NCBI-ProteinID: NP_391708
Pasteur: BG10572
BSORF: BG10572
UniProt: P39594 A0A6M3ZLK0
Structure
PDB: 

Position
complement(3930707..3931375)
AA seq 222 aa
MTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIK
FAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHT
MSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDN
AAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
NT seq 669 nt   +upstreamnt  +downstreamnt
atgactcgtatttctcgggaaatgatgaaagagttattatctgtatacttcattatgggg
tcaaacaatacgaaagccgatcctgttacagttgtacaaaaagcgttaaaaggcggtgcc
accctgtaccagttccgtgaaaaaggcggggatgcgctgacaggagaggctcggattaaa
tttgctgaaaaagcgcaggcagcttgccgtgaagctggtgttccgttcattgtcaatgat
gatgtggaattggctctgaatctgaaagctgatggtatccacatcggccaggaagacgca
aatgcgaaagaggtaagagctgccataggtgatatgattctcggcgtttctgcccatacg
atgtctgaggtgaagcaagccgaagaagacggagcggattatgtcgggcttgggccgatc
tatccgactgaaacgaaaaaagatacgagagcggtacagggtgtatctcttatcgaagca
gtgcgccgccaaggcatcagcattccaattgtcggcatcggcggaatcacaatagataat
gccgcacctgttatccaagcgggggccgatggcgtcagtatgatcagcgccatcagtcag
gcggaggatcctgagagtgctgcacgcaagtttcgtgaggaaattcaaacgtataaaaca
ggaagataa

DBGET integrated database retrieval system