KEGG   Bacillus subtilis subsp. subtilis 168: BSU38300
Entry
BSU38300          CDS       T00010                                 

Symbol
thiM
Name
(RefSeq) hydroxyethylthiazole kinase
  KO
K00878  hydroxyethylthiazole kinase [EC:2.7.1.50]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00899  Thiamine salvage pathway, HMP/HET => TMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU38300 (thiM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.50  hydroxyethylthiazole kinase
     BSU38300 (thiM)
SSDB
Motif
Pfam: HK Carb_kinase TPP_enzyme_C Phos_pyr_kin
Other DBs
NCBI-GeneID: 938519
NCBI-ProteinID: NP_391709
Pasteur: BG10571
BSORF: BG10571
UniProt: P39593 A0A6M3ZIF1
Structure
PDB: 
1EKQ 1ESJ 1EKK 1C3Q 1ESQ

Position
complement(3931372..3932190)
AA seq 272 aa
MDAQSAAKCLTAVRRHSPLVHSITNNVVTNFTANGLLALGASPVMAYAKEEVADMAKIAG
ALVLNIGTLSKESVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAI
RGNAAEIAHTVGVTDWLIKGVDAGEGGGDIIRLAQQAAQKLNTVIAITGEVDVIADTSHV
YTLHNGHKLLTKVTGAGCLLTSVVGAFCAVEENPLFAAIAAISSYGVAAQLAAQQTADKG
PGSFQIELLNKLSTVTEQDVQEWATIERVTVS
NT seq 819 nt   +upstreamnt  +downstreamnt
atggatgcacaatcagcagcaaaatgtcttacggctgtccgccggcatagcccactggtg
catagcataaccaacaatgtcgtaacgaatttcacagcaaacggcctgctcgcgctcggc
gcatcgcccgttatggcgtacgcaaaagaagaggtcgccgatatggcgaaaattgcgggt
gcactcgttttaaatatcggaacactgagcaaggagtcagtcgaagcgatgatcatcgcg
ggaaaatcagctaatgaacatggcgttcccgtcattcttgatcctgtcggtgccggagca
acaccgttccgcactgaatcggcacgtgacatcattcgtgaggtgcgccttgctgcaatc
agaggaaatgcggcggaaattgcccataccgtcggcgtgaccgattggctgatcaaaggt
gttgatgcgggtgaaggtggaggcgacatcatccggctggctcagcaggcggcacaaaag
ctaaacacggtcattgcgataactggtgaagttgatgtcatagccgacacgtcacatgta
tacacccttcataacggccacaagctgctgacaaaagtgacaggcgccggttgcctgctg
acttccgtcgtcggtgcgttttgcgctgtggaagaaaatccattgtttgctgctattgcg
gccatttcttcgtatggggtcgccgctcagcttgccgcacagcagacggctgacaaaggc
cctggaagctttcagattgaattgctgaacaagctttcaactgttactgaacaagacgtc
caagaatgggcgactatagaaagggtgactgtctcatga

DBGET integrated database retrieval system