KEGG   Bacillus subtilis subsp. subtilis 168: BSU38310
Entry
BSU38310          CDS       T00010                                 

Symbol
ywbI
Name
(RefSeq) HTH-type transcriptional regulator YwbI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysR_substrate HTH_1 Fe_dep_repress
Other DBs
NCBI-GeneID: 937626
NCBI-ProteinID: NP_391710
Pasteur: BG10570
BSORF: BG10570
UniProt: P39592 A0A6M3ZHB5
Position
complement(3932198..3933103)
AA seq 301 aa
MDIRHLTYFLEVARLKSFTKASQSLYVSQPTISKMIKNLEEELGIELFYRNGRQVELTDA
GHSMYVQAQEIIKSFQNLTSELNDIMEVKKGHVRIGLPPMIGSGFFPRVLGDFRENYPNV
TFQLVEDGSIKVQEGVGDGSLDIGVVVLPANEDIFHSFTIVKETLMLVVHPSHRLADEKE
CQLRELKDEPFIFFREDFVLHNRIMTECIKAGFRPHIIYETSQWDFISEMVSANLGIGLL
PERICRGLDPEKVKVIPLVDPVIPWHLAIIWRKDRYLSFAARAWLEHTKSYLWDPKKDSK
G
NT seq 906 nt   +upstreamnt  +downstreamnt
atggatatccgccatttaacatatttcttggaagtcgcccgtttaaaaagttttacgaag
gcttcccaatccctttatgtttctcagccgacgatatcaaaaatgatcaaaaatttagaa
gaagagctcggaattgaactgttttaccgaaacggcaggcaggtggaactgactgatgcc
ggtcatagcatgtatgtgcaggcgcaggaaatcattaaatcatttcaaaacctgacgtca
gaattaaatgatattatggaagtcaagaaagggcacgtacggattggactgccgccgatg
atcggatcggggtttttccccagagtgctcggcgatttccgtgaaaactatccgaatgtc
acctttcagctagtcgaagacggttctataaaagtccaagaaggtgtcggggacggctct
cttgatatcggcgttgtggtccttcccgcaaacgaagatatctttcattcgtttacaatc
gtaaaagaaaccttaatgcttgtcgttcacccttcccaccggctggctgatgagaaagaa
tgtcagctgcgtgagttgaaggacgagccttttattttcttcagagaggattttgtcctg
cacaaccgaattatgacggaatgtatcaaggctgggttccggccccatatcatttatgaa
acatcacaatgggattttattagtgagatggtatccgccaaccttgggatcgggcttttg
ccggaacggatctgccgcggccttgacccggaaaaagtgaaagtcattccgcttgtcgat
ccggtcatcccttggcacctcgccattatttggagaaaggacaggtacttgtcgtttgcc
gccagagcttggctcgaacatacgaaatcgtatttatgggacccgaaaaaagatagtaaa
ggatga

DBGET integrated database retrieval system