KEGG   Bacillus subtilis subsp. subtilis 168: BSU38320
Entry
BSU38320          CDS       T00010                                 

Gene name
ywbH
Definition
(RefSeq) holin-like protein CidA
  KO
K06518  holin-like protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU38320 (ywbH)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU38320 (ywbH)
SSDB
Motif
Pfam: LrgA
Other DBs
NCBI-GeneID: 937321
NCBI-ProteinID: NP_391711
Pasteur: BG10569
BSORF: BG10569
UniProt: P39591 A0A6M3ZHQ9
Position
3933209..3933595
AA seq 128 aa
MKKLLLTVIQIALLFIFARLINWVTALLHINIPGSIIGIVILFTLLHFNIIKLEWIELGA
AWLLGELLLFFIPSAVGVIEYGDIMSKFGVSILLVVIISTFVVMVSTGTLTQLIAKRKEK
KHTCSSEL
NT seq 387 nt   +upstreamnt  +downstreamnt
atgaaaaaactgttgctaaccgttattcaaatcgctctgttatttatatttgctcggctg
attaattgggtgacagcccttcttcatataaatattcccggcagtataatagggattgtg
attcttttcacattattgcactttaacattatcaagcttgaatggatcgagcttggtgca
gcgtggcttctcggggagctgcttttattttttatcccgtctgccgtcggagtgattgaa
tacggagacattatgtcgaaatttggtgtcagcattctgcttgttgtcatcatcagcacg
tttgtcgtgatggtgtctacaggaacgcttacacaactcatcgcaaagagaaaggagaaa
aagcatacgtgttcatcggaattgtaa

DBGET integrated database retrieval system