KEGG   Bacillus subtilis subsp. subtilis 168: BSU38330
Entry
BSU38330          CDS       T00010                                 

Symbol
lrgB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LrgB LrgA PMP1_2
Other DBs
NCBI-GeneID: 937323
NCBI-ProteinID: NP_391712
Pasteur: BG10568
BSORF: BG10568
UniProt: P39590 A0A6M4JQM8
Position
3933577..3934254
AA seq 225 aa
MFIGIVSLFLTVLVYLGAKKVYQRFPRVYTSPLLVTPAVLVGLLLLVNVPYESYNLGGGL
LTDMLQPATVAFAIPLYKYFPVLKKYAVEIILNVAVGSCIAIISTALIAKWLHLGTGLID
SLVPRSVTTPIAMNVSEMIGGMPAVTAVFVILTALLGTVIGPMVIRYFRIDNEIARGVLL
GTSAHGAGTSKAFELSSVSGTISSVSMILAAIMTLCAAPFLLSFM
NT seq 678 nt   +upstreamnt  +downstreamnt
gtgttcatcggaattgtaagtttgtttttaacggttttggtgtatttaggagcaaaaaag
gtatatcaacgctttccgcgtgtttatacgtcgccgctattggtgacgcccgctgtatta
gtcggtctgctgctgctggtgaatgtcccgtacgagtcctataatctcggcggcggattg
ctgaccgatatgctacagccggccaccgtggcattcgcgatcccgttatataaatatttc
cctgttttaaagaaatacgcagtggaaattattttgaatgtggccgtcggttcatgcatc
gcgattatttctaccgctcttattgcgaaatggcttcacctcggcaccggcttaattgac
agcctcgtcccaagatcagtgacaacgccgatcgcgatgaacgtatctgaaatgatcggc
ggtatgcctgccgtcacagccgtgtttgtgattttaaccgctttgctcggcacagtgatc
ggcccgatggtcatccgttatttccgcattgataacgaaattgcgcggggcgtgctgctt
ggcacaagcgcgcacggagcgggaacgtcaaaggcatttgagctcagctctgtgtccggc
acgatttccagcgtgtcgatgatcttagctgcgattatgacgctttgcgcggcgccgttt
ttgctttcatttatgtaa

DBGET integrated database retrieval system